KEGG   Hyperthermus butylicus: Hbut_0584Help
Entry
Hbut_0584         CDS       T00468                                 

Definition
(GenBank) hypothetical membrane protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sm_multidrug_ex
Motif
Other DBs
NCBI-ProteinID: ABM80444
UniProt: A2BKD3
Position
complement(553668..554132)
Genome map
AA seq 154 aa AA seqDB search
MPSTSVLTAIVLGLAPGFEPRYTLLLLAAMLGTAPAIAIAVVEVVMLSLALSLLVEKLEV
LLERMGPRMPAAWLILERARRLAEKHRGLVERYGALGLAAFVAIPLPFTGMYTGSLVALI
LGFTRKERLVSLLAGGLASLVLVSTPLIAAENLL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaccagcgtcttgacagccatagtgctggggcttgcgcctggcttcgagccg
cgctatacgttgctactactcgcagctatgcttggcacagcgccagccatagctattgct
gttgttgaggtcgtcatgctctccctcgcactctcgctcctggttgaaaagctagaggtg
ttgctcgagagaatggggccacgcatgccagctgcatggttgatcctcgagagggctaga
aggctcgcagagaagcatagggggctcgtagagcgctacggcgcgcttgggctggcagcc
tttgtcgctatacccctaccattcacgggaatgtacactggctcgcttgtagcgctaata
ctggggtttacgaggaaagagaggctggtatccctactcgctggtggcctggcctcgcta
gtgttagtatcgacacctctcatcgccgctgagaatctgctgtga

DBGET integrated database retrieval system