KEGG   Hyperthermus butylicus: Hbut_0586Help
Entry
Hbut_0586         CDS       T00468                                 

Definition
(GenBank) universally conserved protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIM24
Motif
Other DBs
NCBI-ProteinID: ABM80446
UniProt: A2BKD5
Position
complement(555201..555863)
Genome map
AA seq 220 aa AA seqDB search
MKWRIDYRPAYAVLKVELEPGEEVWSEPGALMLLRGDVEVRTQSGGITSGLLRKLAGSES
FFLNRYRARSRAEVWFAPSLPGDIDTIEVNGEWVIQDASYLAHYGDLKVTASFRGLRGLI
AEGELFWLKVEGHGIVWVNSYGGIERVEVGPGERLVIDNYHFVAMPADTRYTVRKFGGLK
TFLFGGEGFVIEVTGPATVYVQTRILPPFARLLARFLPKS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatggcgtatagactatcgtcctgcttatgctgtgctaaaggtagagcttgaaccc
ggtgaggaagtctggagcgagcctggtgcattgatgcttctccgaggcgatgttgaggtt
agaactcagagtggaggcattacctcgggtttattgcgcaagctggcaggcagtgaaagc
ttcttccttaacagataccgcgccaggagtagagcggaggtatggtttgcaccgagcttg
ccgggagatattgacacgatagaggttaatggtgaatgggtgatacaggatgcgagttac
cttgcacactatggtgacctaaaggttacagcatcgtttcgggggctccgtggccttata
gctgaaggtgagctgttctggctcaaggttgaggggcatggaattgtatgggttaacagt
tatggtggtattgagagggttgaggtcggtcctggagagaggttagtaatcgacaactac
cacttcgtagctatgccagccgatacaaggtatactgtgagaaagtttggtggactcaaa
accttcctcttcggcggcgagggcttcgtcatagaggttactgggcccgcaacggtctac
gtgcaaacgaggatactgccgccgttcgccaggcttctagctaggttcctgcctaagagc
taa

DBGET integrated database retrieval system