KEGG   Hyperthermus butylicus: Hbut_0587Help
Entry
Hbut_0587         CDS       T00468                                 

Definition
(GenBank) universally conserved protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPase AAA_25 Elong_Iki1 IstB_IS21 CbiA PAXNEB RNA_helicase AAA_5 Rad51 AAA_33 TPP_enzyme_C AAA_22 PhoH ABC_tran Sigma54_activat AAA_16 DnaB_C MEDS GFRP ArgK AAA_18 AAA_30 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ABM80447
UniProt: A2BKD6
Position
555926..556678
Genome map
AA seq 250 aa AA seqDB search
MGEPNVKFGVPILDKLLPRGIPRRSLVIMVGDSGTGKSLITQLMAGSFLQRGEKVIYVCL
DDDPESIVSSMESRGIEARRYAREGKLILVDAYASRYGLETEEYVAEKISSLDIHGVSSI
LARLADNNGIRDSGLVILDSLNSFAFRYEPSMLYDFLNMLRVSLAKKRGITTVATFHTPT
QLYAEIAATLEHMADVYIIIRYHEEALEAGVAVRELLIKKAKGVPVMFGWVKFVITDEGI
LEAKVRKIEG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgggagaaccgaatgtaaagtttggagttccaatacttgataagcttctccctcggggg
attcctcgtcgcagcctcgtcataatggttggggatagcggtactgggaagtcgttaatc
acccagctcatggcaggcagtttcctacagcgtggcgagaaagtgatatacgtgtgcctc
gacgatgatcctgaaagcattgtctccagcatggagtcccgtggtatcgaggcaagacgt
tatgcccgtgagggcaagctaatacttgtggatgcatatgcttcacgttatgggcttgaa
acggaggagtatgtagccgagaaaattagcagcctagacatacatggtgtttcatccata
ctagcaagacttgcagataacaatgggataagggactcggggctggtgattctagacagc
ctgaactctttcgccttccggtacgagccctcaatgctatacgacttcttgaacatgctc
agggttagccttgcaaagaagagggggataacgacagtggcaacgttccatacgccaacc
cagctatatgccgagatagctgccacactagagcatatggctgacgtgtacataattata
cgctaccatgaagaagcccttgaggctggtgtggctgttcgcgaactactaatcaagaag
gctaagggtgttccagtaatgtttggctgggttaagttcgtaataactgatgaaggtata
ctcgaggcgaaagttaggaagattgaaggataa

DBGET integrated database retrieval system