KEGG   Hyperthermus butylicus: Hbut_0595Help
Entry
Hbut_0595         CDS       T00468                                 

Definition
(GenBank) Cdc6-1
  KO
K10725  archaeal cell division control protein 6
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hbu03032]
    Hbut_0595
DNA replication proteins [BR:hbu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    Hbut_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cdc6_C AAA_16 AAA_22 AAA ATPase_2 TniB DUF2075 AAA_32 AAA_assoc_2 Phage-MuB_C NB-ARC Creatinase_N_2 PIF1 ResIII Kinesin TsaE
Motif
Other DBs
NCBI-ProteinID: ABM80454
UniProt: A2BKE3
Position
565873..567096
Genome map
AA seq 407 aa AA seqDB search
MEDILEEIFERVVKSRIFRNRDILSPDYIPDRLPHRENEIRKVASVLAQALKGSKPSNLF
IYGLTGTGKTAVTLYVLRRLEAKARQLGVPVRFSYVNTRQRDTPYKVLADIASSIGVRVP
FTGLSTAEVYARIVRGLSRMQGVLIVVLDEVDWLVRRRGDDLLYKLTRIGYELPPGAAKV
SIVGITNDVRFVELLDARVRSSLGEEEIVFPPYNAEQLRDILWERAREAFQPGAVDDSVI
SYCAALAAREHGDARRALDLLRVAGEVAERENADKVTIEHVKKAWSQLERDRVLEVVSTL
PLHARLVLLAAIASGAANGYTTTGELYAAYRELASAVGVESVTQRRVSDIINELDMLGIL
SARVVSRGRYGKTRIITLAADRDTVLEALRRDSRLSELVENLQNPRG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggaggatattctggaggagatatttgagcgtgttgtgaagtcgcgtatcttccggaac
agggacatactgagccccgactatatacccgataggctgccccaccgtgagaacgagata
cgcaaggttgccagtgttctggctcaggcgttgaagggtagtaagcccagcaacctattc
atctacgggctcacggggacggggaagacagcggtaaccctctacgtgttgcggaggctt
gaggctaaggctaggcagcttggtgttcccgtgagattctcctacgtgaacaccaggcag
agggatacaccgtacaaggtgctggcggacatagcctcctcgataggcgtccgtgtcccg
ttcaccgggctttcaactgcagaggtctacgctaggattgtccggggattgtcgaggatg
cagggtgtgctcatcgttgtgcttgacgaggttgactggcttgtccgccgtaggggcgac
gacctactatacaagctgacgaggataggctatgagttgccgcctggggccgcgaaggtc
tcaatagtcgggataacgaacgatgtccggttcgtagagttgctcgatgcacgtgtccgg
agtagcctcggggaggaggagatagtgttcccgccctataacgctgagcagctacgtgac
atactgtgggagagagctagggaggcctttcagccgggcgccgtagacgactccgtgata
tcctactgcgcagcgctggcagctagggagcatggtgatgcacgccgggccctggacctc
ttgagggttgcgggtgaggttgctgagagggagaatgccgataaagtcaccattgagcat
gtaaagaaggcttggagccagcttgagagggatagagtgttagaggttgtctcgacgctg
ccactccatgcccgtctagtgctcctagctgccattgcgagcggtgctgcgaacgggtac
actactaccggcgagctatacgcggcctaccgggagctggcttcagccgtgggagtggag
agcgttacacagcggagagttagcgatatcatcaacgagctggatatgctaggcattctc
tcggcaagggttgtaagcagaggccgctacggcaagacaagaatcataacgcttgcggct
gaccgtgacactgtactggaggcgttgaggagggattcaaggcttagcgagctggttgaa
aacttacaaaaccctagaggttag

DBGET integrated database retrieval system