KEGG   Hyperthermus butylicus: Hbut_0597Help
Entry
Hbut_0597         CDS       T00468                                 

Definition
(GenBank) universally conserved protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0066
Motif
Other DBs
NCBI-ProteinID: ABM80456
UniProt: A2BKE5
Position
568067..568570
Genome map
AA seq 167 aa AA seqDB search
MEIRLQPIGVVRVDASDEEVKKALHGVEGVIEVFPEYEAGLNGIEGFSHIIVIAYLHKVT
DEQRSVLRVRHRRLERLGVDLTGIPEVGVFCTDSPHRPNPIALSIVELVERKGRFLRVRG
LDLFDGTPVLDIKGYDRTRCIREIRVPWWLEELEKRVGRVLGEPSFL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttggagattaggcttcagcctattggtgtggttcgtgttgatgctagtgacgaggaggtg
aagaaggctttacatggcgttgaaggggttatagaggttttcccggagtatgaggcaggg
ctgaatggtattgaagggttttcccacataatagttatagcgtacctacacaaagtcacg
gatgagcagaggagtgtcctccgggtgcgacaccgtaggcttgaaaggctaggtgtcgac
cttaccggtatacctgaggttggcgtcttctgcacagactcgccgcaccggcccaaccct
atagcattgagtatagtcgaactagtcgagaggaagggtaggttcctaagggtacgaggt
ctagacctcttcgatggtacacctgtattggacattaagggatacgataggacgaggtgt
attagggagattagggttccctggtggcttgaagagctcgagaaaagggttggacgagta
ctgggtgagccaagctttctctga

DBGET integrated database retrieval system