KEGG   Hyperthermus butylicus: Hbut_0604Help
Entry
Hbut_0604         CDS       T00468                                 

Definition
(GenBank) hypothetical protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM80463
UniProt: A2BKF2
Position
complement(575538..576080)
Genome map
AA seq 180 aa AA seqDB search
MYNIESQSCKAPGYCWHHCIPPEFWTSFSSYYRTRTVPCRHVRLSLVLRAERDTSLCAYL
HGRLPGWRSSCRARNGARLDIRWPARRTAGFWHCDNCWPRPTLHLHARNGILPEKANGDP
SQIRGRGPRKADRETLLVRCNTNYNHYRLHSPPHSQHLRAGSSSYTTQPLEHRHLGATRP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgtataacattgaatctcaatcttgcaaagctcctggttattgctggcatcattgtatc
cctcctgagttctggacatccttcagcagctattatcggactcgtactgtaccttgtagg
catgtacggcttagcctcgtactacgagcagagcgagatacttcgctatgcgcttatctc
cacggtaggcttcctggctggcgtagtagttgccgtgctcgtaatggggctcggctcgat
attcgctggcctgctcgccggaccgccgggttttggcactgcgataattgctggcctcgt
cctactctacatctccatgctcgcaatgggatactaccggagaaggctaatggagatcct
agccagatacggggacgagggcctcgcaaggctgaccgggaaactctactggtacggtgc
aatactaactataatcattataggcttcatagtcctcctcatagccagcatcttagagct
ggtagtagtagctacactacgcagccgctagaacaccgccatctgggagctacacgccct
tag

DBGET integrated database retrieval system