KEGG   Hyperthermus butylicus: Hbut_0608Help
Entry
Hbut_0608         CDS       T00468                                 

Definition
(GenBank) ABC-type dipeptide/oligopeptide transport system, permease
  KO
K02033  peptide/nickel transport system permease protein
Organism
hbu  Hyperthermus butylicus
Pathway
hbu02024  Quorum sensing
Module
hbu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hbut_0608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hbu02000]
    Hbut_0608
Transporters [BR:hbu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Hbut_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABM80467
UniProt: A2BKF6
Position
complement(579549..580547)
Genome map
AA seq 332 aa AA seqDB search
MANLRRFLLRRLITFVPTVIGVTFLVYIIAVQIPANPARLWAGGEKADPEVVQRLIEEYH
LNDPWYVQYYFFLKKVLSGEAVSPVTHTNVWDQIMEKLLTVTLPLTLFAFLFIITIGIPL
GIIAAIKRDTWIDVVIRAFALIGISTPIFWLAYLLIFVLQPRGLISLTGFPMPDYRITGI
PILDAFLKMDIEYIVLFIKRMWLPAFMLAYGGIGFITRIVRNSFLDAFSGEYINFMEARG
FPRGRIYIHVLRNALTPVVTVLGLMFGGLLAGAPITETVFNLPGLGTYMIRAIHNFDYIV
LIAAVLFIALIYVTINLIIDILYAIIDPRVRY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttggccaatctacgccgcttcctactccgcagactcataacgttcgtgccaacagtgata
ggtgttacattcctcgtctacattattgctgtacagataccagctaatccagctaggcta
tgggctggcggcgagaaggctgaccccgaggttgtccagaggcttatcgaggagtaccac
ctcaacgacccctggtatgtacaatactacttctttctcaagaaggtgctgagtggtgag
gctgtgagccctgtgacgcacacaaatgtctgggatcagattatggagaagctgctgacg
gttacgctgcctctaacactattcgcattcctattcataataactatcggtatacctcta
ggcataatagccgccatcaaaagggatacgtggattgatgttgtgataagagctttcgcc
ctcatcggaatatcgacgccaatcttctggctagcctaccttctaattttcgtgctgcag
ccacgcggcctcataagccttacaggattcccaatgccagactataggattaccggcata
ccgatactagatgccttcctaaagatggacatcgagtacatagtattgtttatcaaaaga
atgtggctgccggcattcatgctcgcctacggcggcataggctttataacaaggatcgtg
cggaatagcttcctcgacgcgtttagcggagaatacataaacttcatggaagcccgtggc
tttccccgtggtagaatctacattcacgtgctccgaaacgcgctaacccccgttgttaca
gttctgggcttaatgtttggcgggctcctggcgggcgcgccgattactgagaccgtcttt
aacctgccggggcttggcacgtacatgatcagggcgatacacaacttcgactacatagtg
ttgatagcagctgtgctattcatagcactgatatacgtgactataaacttgatcatagac
atactttacgccatcatagaccccagggtgagatactag

DBGET integrated database retrieval system