KEGG   Hyperthermus butylicus: Hbut_0613Help
Entry
Hbut_0613         CDS       T00468                                 

Definition
(GenBank) High-affinity branched-chain amino acid transport ATP-binding protein F
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
hbu  Hyperthermus butylicus
Pathway
hbu02010  ABC transporters
hbu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Hbut_0613
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hbut_0613
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hbu02000]
    Hbut_0613
Transporters [BR:hbu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Hbut_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 AAA_29 AAA_23 AAA_15 ABC_ATPase Dynamin_N AAA_33 AAA_10 NACHT AAA_30 MMR_HSR1 AAA_14 NB-ARC AAA_27 ATPase_2 AAA_35 RsgA_GTPase AAA_25 SbcCD_C AAA_24 KdpD cobW
Motif
Other DBs
NCBI-ProteinID: ABM80472
UniProt: A2BKG1
Position
complement(588109..588876)
Genome map
AA seq 255 aa AA seqDB search
MNGLPLVVEELHAGYGKLQILYGVSVKAKPGELVAIVGPNGSGKSTLLKTIFGFTTVYRG
RIILGGRDITKIPPSRKPYLGLAYVPQVDNIFARLTVEENLKLSRIVFRERYASSPSPQK
DGASPDKLFEDMLEEIYNMFPVLRERRKQKAGTLSGGERQMLAIARALLMKPQVLLLDEP
TAALAPKIAEEIFRKIREIADRGVTVLLVEQNARRALEIADRGYILVQGRVAYEGPSKEI
LSHPELSKLYLGISK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggtctccccctcgtcgtcgaggaactacacgcaggctatgggaagctacagata
ctctacggcgtatcggtaaaggctaagcctggagaattggtagccattgttgggccaaac
ggtagcggcaagagtacactcctaaagacgatattcggcttcacaacagtatatcgtggc
aggataattctcggcgggagagacatcaccaagattcctcccagtagaaagccctacctc
gggctagcctacgtgccacaggtggacaacatatttgcaaggctcaccgttgaggagaac
ctaaagttgtccaggatagtgtttagggaaaggtatgcgagtagcccttcaccgcaaaag
gatggtgctagtcctgataagctgtttgaagatatgctagaggagatctacaacatgttc
ccagtgctgcgcgagaggaggaaacagaaagcgggcacgctgagtggcggcgagagacag
atgttagcaatagcgagggcactcctcatgaagccccaggttctactacttgacgagcct
accgctgcactggcacccaagattgctgaagagatattcaggaagataagggaaatagct
gataggggtgtaaccgttctcctcgtggaacagaatgccaggagggcgctcgagatagct
gatagggggtatatactcgtccagggccgagtagcctatgagggcccgtccaaggagata
ctgtcacatcccgagctcagcaagctataccttggcatctcaaagtag

DBGET integrated database retrieval system