KEGG   Hyperthermus butylicus: Hbut_0616Help
Entry
Hbut_0616         CDS       T00468                                 

Definition
(GenBank) ABC-type branched-chain amino acid transport, periplasmic component
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
hbu  Hyperthermus butylicus
Pathway
hbu02010  ABC transporters
hbu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Hbut_0616
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hbut_0616
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hbu02000]
    Hbut_0616
Transporters [BR:hbu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Hbut_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 LppC YjeF_N YjbE CdhD
Motif
Other DBs
NCBI-ProteinID: ABM80474
UniProt: A2BKG3
Position
592039..593364
Genome map
AA seq 441 aa AA seqDB search
MKGFRAISIYVVVGLLILGLLVGLAVGYFIGGGGGESKSATSTPAFNESSSVNFTAAGGG
LQGEIPIGILLPQTGSLAQDGRDNIKAAKLAIEDFNKLLESIGAPFRFKAIVADSGTDPN
KALAALQTLYNQHHVQIVVGTDSSWVLSGVMSFANEHHIVMISPASTSPALALKDYIFRI
VGNDKGQGKALAALVHNNGFNAAVVIFRDEAYGRGIAEAFKENFEALGGTAVLVPYNPQK
SDYAPEVQKLASEVEKLLNEGKNVAVIIVAFETDGINILSHAADIPVLSQVKWFASESIR
SPALLKAPDKVRQFLAKVELEGTFPIPPKSPLGEWFEKHFEEVYGHPPESPFSPYAYDAA
YLACLAVTIAGKYDGTVIAKVLPEVAKNYYGVTGWKLLDENGDLKYQEYSIWKYVCEGGS
CEFIDIAIYDPQSGKIQQIAG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatttagagcaatctcaatatatgttgttgtgggcctgctaatactgggcctg
ctagtaggcctagcagtaggctactttattggtggcggcggcggtgagagtaagtcagct
actagtacaccagccttcaacgaaagctcaagcgtaaactttactgctgcaggaggcggc
cttcagggcgagatacctatcggcatattgctcccgcagacgggaagcttggcgcaggat
ggaagggacaatattaaggctgccaagctggcaatagaagactttaacaagctactagag
tcgataggtgctccattccgctttaaggctatagttgctgatagtggtactgaccccaat
aaggcgcttgcagcactacagacactctacaaccagcaccacgtacagattgtcgtgggt
actgatagcagctgggtgctaagcggcgtaatgagctttgccaacgagcaccacatagtc
atgataagcccagccagtacgagccctgcgctagcactgaaggactacatattcaggatc
gttggcaacgataagggtcagggtaaggcgctagcagcactagttcacaataatgggttc
aacgctgctgtcgtgatattcagagacgaagcttatggccgtggcatagctgaggcattc
aaggagaactttgaagccttgggtggtacagcggtcctagtaccgtataacccacagaag
agcgactatgctccagaggttcagaagctagcatcggaggttgagaagctcctcaacgag
ggtaaaaatgttgcagttatcatcgtcgcgttcgaaacagacgggataaacatactgagc
catgcagccgatataccggtgctaagccaggtaaagtggtttgccagcgagtctatcagg
tcgccagcgctgctcaaggcccctgacaaggttagacagtttctagccaaggtggagctt
gagggtacattcccaataccgcccaagagcccgctaggtgaatggtttgaaaagcacttc
gaggaggtatacggccatccgccagagtctccgttctcgccatacgcttatgatgccgcc
tacctggcatgcctggctgtaaccattgcaggtaagtacgacggtacggtcatagctaag
gtgttgccggaggtggctaagaactactatggtgttacgggctggaagttgctagacgag
aatggtgacctcaagtaccaggagtacagcatctggaagtacgtctgcgaagggggatcc
tgcgagttcatcgatatcgccatatacgatccacaaagtggcaagatacagcagatagca
ggctag

DBGET integrated database retrieval system