KEGG   Hyperthermus butylicus: Hbut_0618Help
Entry
Hbut_0618         CDS       T00468                                 

Definition
(GenBank) predicted Zn-dependent protease
  KO
K06974  archaemetzincin [EC:3.4.-.-]
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hbu01002]
    Hbut_0618
Enzymes [BR:hbu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     Hbut_0618
Peptidases [BR:hbu01002]
 Metallo Peptidases
  Family M54
   Hbut_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M54 Peptidase_M10 Peptidase_M66 Reprolysin_3 DUF4953 Metallopep Chol_subst-bind Peptidase_M43
Motif
Other DBs
NCBI-ProteinID: ABM80476
UniProt: A2BKG5
Position
complement(594378..594947)
Genome map
AA seq 189 aa AA seqDB search
MVVIHIAGTHVERDDLVFLSARLREAYSNAHVNIVEQELEPPPSAYDPVRRQYLSDAILE
LAAILHEKLRGDALLVVAGFDAYTPGLNFVFGQALLGRGVAVVYTARLHPEFYGEPPNEA
LYRRRLLKEALHELGHALGLEHCATPGCVMNFSNSIWGVDKKKPMYCRRCTVKLAARGVR
VSPAYILGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcatacacattgcgggtacacacgttgagcgggatgatctggtgtttctctct
gctaggctcagggaggcctacagtaacgcacacgtaaacatcgtggagcaggagctggag
ccgcctccgtcagcctatgacccggtgcgccgccagtacctcagcgacgctatactggag
cttgcagctattctccacgagaagcttaggggcgatgccctactggttgtggcaggcttt
gacgcctatacgccaggcctcaactttgtatttggccaggcactcctgggccggggtgtc
gccgtggtctacactgcgaggctgcacccagagttctacggtgagccgccaaacgaagct
ctctatcgtaggaggcttctgaaggaagcgctacacgagcttggccacgcccttggcctg
gagcactgtgctaccccgggctgcgtcatgaacttcagcaatagcatatggggggttgat
aagaagaaaccaatgtactgtaggcggtgtacagtaaaactggccgccaggggtgtaagg
gtctcgccagcctacatactcggagcctga

DBGET integrated database retrieval system