KEGG   Hyperthermus butylicus: Hbut_0622Help
Entry
Hbut_0622         CDS       T00468                                 

Definition
(GenBank) Calcium-gated potassium channel
  KO
K10716  voltage-gated potassium channel
Organism
hbu  Hyperthermus butylicus
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hbu02000]
    Hbut_0622
Transporters [BR:hbu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Hbut_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N Ion_trans_2 Ion_trans TrkA_C Castor_Poll_mid
Motif
Other DBs
NCBI-ProteinID: ABM80480
UniProt: A2BKG9
Position
597213..598211
Genome map
AA seq 332 aa AA seqDB search
MIFVIYRVIRRLVRELAGRITIILVAFAGLLLVAGAIFSYVEYRGLWEGVYWAFVTATTI
GYGDIYPETWLGRVVAVATAVAGIALFTALIGVVADHFAAKAARAERGELPVREKGHIVI
MGWTRHTERLVEELRANLSDKHIVLLNTDGPVIRTASITTVRGDPTRTKDQLKASTDKAW
AIVVSTGDDSKTILAVLHARRLNPQALIVAEALEEENIDPIRQAGADRVVYTGGLGGDLL
ASAVFEPSVPRLIADLASSVEGIADLVEEPATSYAGKTFLEALVEAKKTEDKLLVAVVKH
DGMIIASPPPDYRIEDGDKLIVLVKSHREKSS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcgtgatataccgtgtcataaggaggttggttagagagcttgcaggcaggata
acaattatccttgtcgcgtttgcggggcttctactcgttgcaggtgccattttcagctat
gtcgaatatcgtggcctctgggagggcgtctactgggccttcgtgacagccacgacgata
ggctacggcgatatatacccggagacgtggctcgggcgcgtcgtagcagtagcaacagct
gtagctggcatagccctatttacggcactcataggcgttgtggcagaccattttgccgcg
aaagctgccagggctgagaggggtgagctaccagtacgcgagaagggccacatagtgatt
atgggctggacacgtcatacagagagactagtcgaggagctgcgcgcaaatctttccgac
aagcacatagtcctgctaaacactgatggccccgtgatacgtacagcaagcattacaacc
gtgcgtggtgaccccacgaggaccaaggaccagctaaaagctagcacagacaaggcctgg
gcaatagtagtctctactggtgacgactcaaagacgatactagcagtactccacgccagg
aggctcaacccccaagcactaatcgtcgcggaggcgctcgaagaggagaacatcgacccg
ataaggcaggctggcgccgaccgtgtagtatacacgggtggtcttggaggagacctcctg
gcaagcgcagtcttcgagccctcagttccacggctcatagctgacctagctagtagtgtt
gagggcatagcagaccttgtagaggagcccgccacgagctatgcaggcaagacgttcctg
gaggcactagtagaggctaagaagaccgaggacaagctattggtagccgtggtaaagcat
gacgggatgataatcgcaagcccgccaccagactaccggatagaggatggcgacaagcta
atcgtcctagtaaagtcgcacagggagaagagtagctga

DBGET integrated database retrieval system