KEGG   Hyperthermus butylicus: Hbut_0729Help
Entry
Hbut_0729         CDS       T00468                                 

Definition
(GenBank) pyruvate synthase subunit, porB
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00010  Glycolysis / Gluconeogenesis
hbu00020  Citrate cycle (TCA cycle)
hbu00620  Pyruvate metabolism
hbu00633  Nitrotoluene degradation
hbu00640  Propanoate metabolism
hbu00650  Butanoate metabolism
hbu00680  Methane metabolism
hbu00720  Carbon fixation pathways in prokaryotes
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
hbu01130  Biosynthesis of antibiotics
hbu01200  Carbon metabolism
Module
hbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0729
   00020 Citrate cycle (TCA cycle)
    Hbut_0729
   00620 Pyruvate metabolism
    Hbut_0729
   00640 Propanoate metabolism
    Hbut_0729
   00650 Butanoate metabolism
    Hbut_0729
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbut_0729
   00680 Methane metabolism
    Hbut_0729
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hbut_0729
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hbut_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C E1_dh Glyco_transf_4 DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABM80583
UniProt: A2BKS2
Position
complement(717130..718038)
Genome map
AA seq 302 aa AA seqDB search
MAVNLRTLPKKRYVLPGTAACPGCPEAMGLRFLGMALGEKAVLVVPAGCTSVIQGLGPKQ
ATNMPILNIVFAASAATASGLSRALKRRGVDAQVVVWAGDGGTADIGFQALSAAAERGED
IIYICVDNEAYMNTGIQRSGLTPYGAWTTTTHTGKRESKKPMPQIVAAHRVPYVATASVG
YPWDFIAKLRKAASIRGFKYIHLHAPCPVGWRFDPGLTVHIAKLAVETGAWILYEYENGR
LKLNPPSNKLIDPSKRKPVEEYLKLQGRFRHFKPEDVQRFKEDIERNWQEIIAILKAQGD
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttaacttgaggacgctacccaagaagaggtatgtgctgccaggtacagcggcg
tgccccggctgcccagaggctatggggctacgcttcctcggcatggccctgggcgagaag
gctgtcctggtcgtcccagcaggctgcacatccgtcatccagggcctcggaccaaagcag
gcaacgaatatgccgatactaaacatagtcttcgccgctagtgctgccacagccagcggg
ctctcccgcgcactgaagaggagaggcgtcgatgcccaggtggtggtgtgggctggcgac
ggcggcacggccgacataggcttccaggcgcttagcgctgcggcggagaggggcgaggac
atcatatacatctgtgtggacaacgaggcctacatgaacactggcatccagaggagcggc
ttgacaccctatggcgcctggacaaccacgacccacaccggcaagcgggagtcgaagaag
ccgatgccccagatagtagctgcgcatagggtgccatacgtagccacggcgagtgttggc
tatccatgggacttcatagcaaagctgaggaaggcggcgagcatccgtggcttcaagtac
atacacctccacgccccgtgcccggtgggctggagattcgaccccgggctaacagtccac
atagcaaagctagcagtggagacgggcgcctggatactctacgagtacgagaacggcagg
ctcaaactcaacccgccaagcaacaagctcatagacccgtcgaagaggaagccggtggag
gagtacctcaagctgcagggccgcttccgccacttcaagccagaggacgtacagaggttc
aaggaggatattgagaggaactggcaggagataatagcgatactgaaggcacagggagac
ctaaagtag

DBGET integrated database retrieval system