KEGG   Hyperthermus butylicus: Hbut_0946Help
Entry
Hbut_0946         CDS       T00468                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00010  Glycolysis / Gluconeogenesis
hbu00051  Fructose and mannose metabolism
hbu00562  Inositol phosphate metabolism
hbu01100  Metabolic pathways
hbu01110  Biosynthesis of secondary metabolites
hbu01120  Microbial metabolism in diverse environments
hbu01130  Biosynthesis of antibiotics
hbu01200  Carbon metabolism
hbu01230  Biosynthesis of amino acids
Module
hbu_M00002  Glycolysis, core module involving three-carbon compounds
hbu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0946
   00051 Fructose and mannose metabolism
    Hbut_0946
   00562 Inositol phosphate metabolism
    Hbut_0946
Enzymes [BR:hbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hbut_0946
Exosome [BR:hbu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hbut_0946
  Exosomal proteins of bladder cancer cells
   Hbut_0946
  Exosomal proteins of melanoma cells
   Hbut_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM IGPS ThiG FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABM80794
UniProt: A2BLD3
Position
complement(953145..953924)
Genome map
AA seq 259 aa AA seqDB search
MGTVLLSGLFARYTVKREKGDAMTSRRTPILAINFKAYPTAFGEKGLAIALAADHVAAEY
GGSLEVIVAVPATEIVRVSDAVEHVKVYSQHADAVEPGPHTGFLPLEALREAGARGTIIN
HSEHRVGLNDIDFVIRRATSLGMEVLVCADTPTAAAAAAALSPTMIAIEPPELIGTGIPV
SRAKPEIVRETVRLIRMINPEAVVLTGAGITVGEDAVAAIRLGTQGVLVASAVMKASDPE
AKIRELAEALARAAEKELG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgggcactgtactgctatctgggctttttgcccgctacacggtgaagagagagaagggg
gatgcaatgactagtcgccgcacgcccatactcgcgataaactttaaggcataccctacg
gcatttggtgagaaaggcttagccatagctcttgcagcagaccatgtagccgccgagtat
ggaggcagccttgaggttattgtggctgttccagcaaccgagatagtacgggtaagcgat
gctgtagagcacgtaaaggtgtatagccaacatgctgacgcggtggagcccgggcctcac
acgggatttctcccactagaggctctaagagaagctggtgcccgcggaacaatcataaac
catagcgagcaccgtgtcgggctaaacgatatagacttcgtgattagaagagcgacaagc
ttaggcatggaggtacttgtatgcgctgatactcctacagccgcagctgctgcggcggca
ttgtcgcctacgatgattgctatcgagccaccagagcttattggcaccggcatacccgtt
tctagagccaaacctgaaattgtgagagaaactgttaggctgataaggatgattaaccca
gaggcagtagtgttgacaggtgcaggcataacagttggagaggatgctgtggcagcgata
aggcttgggacgcagggtgtacttgtagcctctgcggtcatgaaggcctcggatcccgag
gcaaagatccgggagctggctgaggcgctggctagggccgccgagaaggagctaggttag

DBGET integrated database retrieval system