KEGG   Helicobacter pylori PeCan18: HPPC18_03410Help
Entry
HPPC18_03410      CDS       T02036                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00071  Fatty acid degradation
hca00072  Synthesis and degradation of ketone bodies
hca00280  Valine, leucine and isoleucine degradation
hca00310  Lysine degradation
hca00362  Benzoate degradation
hca00380  Tryptophan metabolism
hca00620  Pyruvate metabolism
hca00630  Glyoxylate and dicarboxylate metabolism
hca00640  Propanoate metabolism
hca00650  Butanoate metabolism
hca00900  Terpenoid backbone biosynthesis
hca01100  Metabolic pathways
hca01110  Biosynthesis of secondary metabolites
hca01120  Microbial metabolism in diverse environments
hca01130  Biosynthesis of antibiotics
hca01200  Carbon metabolism
hca01212  Fatty acid metabolism
hca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPPC18_03410
   00630 Glyoxylate and dicarboxylate metabolism
    HPPC18_03410
   00640 Propanoate metabolism
    HPPC18_03410
   00650 Butanoate metabolism
    HPPC18_03410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPPC18_03410
   00072 Synthesis and degradation of ketone bodies
    HPPC18_03410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPPC18_03410
   00310 Lysine degradation
    HPPC18_03410
   00380 Tryptophan metabolism
    HPPC18_03410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPC18_03410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPPC18_03410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPPC18_03410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hca04147]
    HPPC18_03410
Enzymes [BR:hca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPPC18_03410
Exosome [BR:hca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPPC18_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFI02441
UniProt: I0EHM2
Position
complement(715922..717097)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGARQMGVSVLKDALNASGLEPSDVDSVVLGNVLGAG
LGQNIARQIQLDSGIPNDRNAFSVNMVCGSSMKAIQLAHDSIVLGRNEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIASKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCNAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcgtagtgctgtagggagttttttaggctct
ctaaagaatgtgggtgctaggcaaatgggcgttagcgtgcttaaagacgctttgaacgcg
agcggacttgagcctagcgatgtggattctgtcgttttaggcaatgtcttaggtgctggt
ttgggtcaaaatatcgccagacagatccaactggattctggcatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctatccaattagcgcatgat
agcattgtgcttgggcgcaatgaagtggtggtgtgcggtggcgtggagaacatgagcgca
gcaccctatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagatcaagacgcattcgcactc
caatcgcaactcaaagcgagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgagtaaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgcctttaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagcattatcattttatgcaacgct
aaaaaagcgcaaaaactggggttaaaaacaatggccactatcaaggggtttggtttgggc
ggttgcagtccggatattatgggcatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcttttgctgcg
caaagcatcgccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagcgattggtcaccctattggcgcgagcggcgctagaatcttagtcacttta
ttgcatgaaatgaaaaggagcgggcatggcgtgggttgtgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system