KEGG   Helicobacter pylori PeCan18: HPPC18_07390Help
Entry
HPPC18_07390      CDS       T02036                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00900  Terpenoid backbone biosynthesis
hca01100  Metabolic pathways
hca01110  Biosynthesis of secondary metabolites
hca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPC18_07390
Enzymes [BR:hca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPPC18_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFI03202
UniProt: I0EJT3
Position
complement(1540378..1541181)
Genome map
AA seq 267 aa AA seqDB search
MHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKKFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYTPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttaccacaagcttatttctcgcatgtgtttagtcaaagataagctaaaggatatt
attagcgtcaaaagtgcgctttccttttcactaaaaggggattttgattgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaaattc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtgggt
gcagacaccaattttttcatctcgcaacacaaaagcgctaacgctacttcttacggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatacgccaaac
catgttttttgcagcaccaaagccatctatcaagcctataaacctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttgcgacagaaac
gaattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggtatagaa
agcgaactgggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system