KEGG   Helicobacter cinaedi CCUG 18818 = ATCC BAA-847: HCBAA847_0596Help
Entry
HCBAA847_0596     CDS       T02494                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hcb  Helicobacter cinaedi CCUG 18818 = ATCC BAA-847
Pathway
hcb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hcb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HCBAA847_0596 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hcb03011]
    HCBAA847_0596 (rplV)
Ribosome [BR:hcb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HCBAA847_0596 (rplV)
  Bacteria
    HCBAA847_0596 (rplV)
  Archaea
    HCBAA847_0596 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAM31838
UniProt: I7GT45
Position
588653..589207
Genome map
AA seq 184 aa AA seqDB search
MSRALLRYIRLSPTKARLIAREVQGMNAELAIASLEFTPNKAAKLISKVIASAVANGGYD
AQDVIVTSCRVDAGPVLRRFMPRAKGRATPIRKPTAHILVEVGTQKSQAKQVESKSKDSK
PEDSKKIETKEASAAKKPATKAKVVEKAPKADKVESKEVKPKSTPKAPITKKTTAKKKTE
GEEQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagcattgttaagatatattcggttgtctccaacaaaagcgcgtcttatcgca
agagaagtgcagggtatgaatgctgaacttgcgattgcaagtttggaatttactccaaat
aaggctgctaagcttatttcaaaagtgattgcttcagcggtggcaaatggcggctatgat
gcgcaagatgtgattgtaacttcttgccgtgttgatgctggtcctgtgctaaggagattt
atgccacgcgctaaaggtagggctacacctattaggaagccaacagcacatattttggtc
gaggtaggcacacaaaagtctcaagctaagcaagtagaatctaagtctaaagattcaaaa
cccgaagattctaaaaagatagaaactaaagaagctagtgccgctaagaaaccagctaca
aaagcaaaagtagtagagaaagccccaaaagctgacaaggtagaaagcaaagaggttaag
ccaaaatcaactccaaaggctcctattacgaaaaagacaacagcgaagaaaaaaactgaa
ggtgaggaacaataa

DBGET integrated database retrieval system