KEGG   Helicobacter cinaedi CCUG 18818 = ATCC BAA-847: HCBAA847_1920Help
Entry
HCBAA847_1920     CDS       T02494                                 

Definition
(GenBank) truncated aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hcb  Helicobacter cinaedi CCUG 18818 = ATCC BAA-847
Pathway
hcb00970  Aminoacyl-tRNA biosynthesis
hcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HCBAA847_1920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hcb03029]
    HCBAA847_1920
Enzymes [BR:hcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HCBAA847_1920
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HCBAA847_1920
Mitochondrial biogenesis [BR:hcb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HCBAA847_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAM33138
UniProt: I7GTV5
Position
1807398..1808408
Genome map
AA seq 336 aa AA seqDB search
MDLNRACTPLLEIVSEPDMRSSDEAIAYLKKLHSIVRFLGISDANMQEGSFRCDANVSIR
PRGDSRLYTRVEIKNLNSFKFIQKAIEYEVERQIEAWEDGKYESQVVQETRLFDTAKGVT
RSMRGKEEAADYRYFPDPDLLPVFIDEELMKQGKQIPEMPDEKAQRYVKDFGIKPYDAGV
LTSSLELTKYFESMLDFGASAKGSLTWLTTELLGRLKGENTLQTCGIDSATLATLVKRID
EGKISGKSGKEILDVLVENRGGDVDSLIDSMGLAQVNDDGAILAAIDSVLSANPDKVAEF
KSGKDKLFGFFVGQVMKASKGANPARVNELLKEKLQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtggatttaaaccgcgcttgcacgccgcttttagagattgtaagtgagccagatatgaga
agtagcgatgaagcgatagcttatcttaagaaactgcattccatcgtgcgatttttaggc
ataagtgatgccaatatgcaagaagggagcttccgctgtgatgccaatgtctctatccgc
ccaaggggagattctaggctttatacacgcgtagagattaaaaatctaaactcctttaaa
tttatccaaaaggccatagaatacgaagtggagcggcagattgaagcgtgggaagatggc
aagtatgaatcacaagtcgtgcaagaaacgcgcctttttgacaccgcaaagggcgtaacc
cgctcaatgcgtggcaaggaagaagcagcagattatcgctacttcccagacccagatttg
ctgcctgtgtttattgatgaagagttaatgaaacagggcaaacaaatcccagaaatgcca
gatgaaaaagcacagagatatgtcaaggactttggcattaagccctatgatgccggtgtg
ctgacttctagcctagagctaacaaaatactttgaatctatgctagattttggtgcaagt
gcaaaaggctcactcacttggctaactaccgagcttctagggcggctaaagggcgaaaac
acactgcaaacttgcggtatagattctgccacacttgccacactagttaaacgcatagat
gaaggcaaaatcagcggcaaaagcggcaaagaaatcctagatgtgcttgtggaaaatcgc
ggcggcgatgtggattctctcatagattctatgggattagcacaagtgaatgacgatggt
gcaatcctagctgccatagattctgtgctaagtgccaaccctgataaagtcgcagaattt
aaaagcggtaaggataagctttttggcttttttgtagggcaagtgatgaaagcaagcaaa
ggtgcaaaccccgctcgtgtcaatgagcttttaaaagagaagctacaatga

DBGET integrated database retrieval system