KEGG   Candidatus Hodgkinia cicadicola TETUND1: HCTETUND1_112Help
Entry
HCTETUND1_112     CDS       T03595                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
hcc  Candidatus Hodgkinia cicadicola TETUND1
Pathway
hcc00860  Porphyrin and chlorophyll metabolism
hcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCTETUND1_112 (cobQ)
Enzymes [BR:hcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     HCTETUND1_112 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_26 CbiA GATase_3
Motif
Other DBs
NCBI-ProteinID: AHL30925
UniProt: W8Q477
Position
complement(88574..90025)
Genome map
AA seq 483 aa AA seqDB search
MTKRARALMVQATGSSAGKTLLCLCLCKIAKGMGIDVVPFKAQNMSNNTVVTAKGGEASA
AQWLQAISCSLVVNVNMSPVVIKPRAGFRSQVLVYGLSECDGYVYPGSAEFRRFARASII
SSFEQLSAHHELVVIEGSGASSEVNLREYDTSNMWLAKALNCGVVLISDIERGGALAALV
GTRWLLAPNELNLVKGFVINKFSGKLSLLRPGLDLVKNKTGWPCYGVVPWLADSHKLPSE
DSLWVRRNVVDSAYVGIIIDLPFFCNYNDYTPLSTQLGISVLYSKAPPACVWENVKFVIV
PDTTSVRAALEYITNSGWDFYIRSACRKGVLIVGVGAGLLMLSNRFALADATLFGLGLLS
ANVSVLNILPLQVGCVCKVLNAAVSVGVSKLMCFSRVGANSAPVLPLLTNANVEYGVYSN
NVWGVGVQGLFLNDLFRHSFLEALGVRSRFDSYLGKVDEAIAGVAYRVMSNLSPEFLSLI
EGG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagagcgagagccttaatggtgcaagccacaggctctagcgctggcaaaacg
ctcctgtgcttgtgtttgtgtaaaatagccaagggaatggggattgatgtcgtgcctttt
aaagcccagaatatgagcaacaacactgtagttacagccaaaggcggcgaagccagcgcc
gcgcagtgattgcaagctataagctgttctttggtggttaatgttaacatgagccctgtt
gttatcaaacctagagcaggctttaggagccaggttctagtttatggtctatccgagtgc
gacggttatgtttatcccggcagcgccgagtttagacggttcgcgcgcgctagcattatt
tctagttttgagcagctttcggcgcatcatgagctcgttgtaatcgaaggctctggcgcc
tcatcggaggttaatttgcgcgagtatgacacaagcaacatgtggttggctaaagcatta
aattgtggagtggtgttaatttcggatatagagcgtgggggcgcgctagcggcgttagtg
ggcactcgttggctgttagcgcccaacgagcttaacctggttaaagggtttgtaataaac
aagttttctggtaagctgagtctgcttcggcctggccttgatcttgttaaaaacaaaact
ggttgaccgtgttatggcgtagtgccttggttggcggatagccacaagctgccttcggaa
gactcgttgtgggtgaggcgaaacgttgtggacagcgcctacgttggtataataatagac
ttgccgtttttttgtaattataacgactatacgccattgagcacacaacttggaattagt
gttctgtactctaaggcgcctcctgcttgcgtttgggaaaacgttaagtttgtgatcgtg
ccggacactacgtccgttagagcggcgctggagtatatcacgaactcgggctgagacttt
tacattagaagcgcatgcagaaaaggagtattgatagtcggtgttggcgccggattgtta
atgctgagtaaccgttttgcgttggccgacgccactttgtttggcttggggttgttaagc
gcgaacgtctcggttctgaacattttgccgttgcaggtcggctgtgtttgcaaagtttta
aacgcggccgttagcgttggcgttagcaagctaatgtgttttagcagagttggcgccaac
tctgcgcccgttctgccgttgcttactaacgcaaacgtggaatatggggtgtacagcaac
aacgtttgaggcgtgggtgttcagggcctgtttttaaacgatttgtttagacattctttt
ctcgaggcgttgggggtacgctctcgtttcgatagctacttaggcaaagttgacgaggcc
atagctggagtggcttacagagttatgtcgaatttaagcccagagtttctgtcgttaata
gaaggcggttaa

DBGET integrated database retrieval system