KEGG   Helicobacter cetorum MIT 00-7128: HCW_00720Help
Entry
HCW_00720         CDS       T02032                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HCW_00720 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hce03011]
    HCW_00720 (rplV)
Ribosome [BR:hce03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HCW_00720 (rplV)
  Bacteria
    HCW_00720 (rplV)
  Archaea
    HCW_00720 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: AFI03437
UniProt: I0EKG8
Position
complement(131900..132271)
Genome map
AA seq 123 aa AA seqDB search
MSRALLKFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVIASAVANGGLD
AKNAVIISCRVDAGPVLRRSMPRAKGRATAIRKPTSHVLVVVAEAKESVQSSKSNKKTKV
KGE
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagcattattaaaatttgtgcgattatctcctactaaggcaagattgattgct
agacaaattcaaggtatgaatgctgagttagcgattgctagtttagagtttactcccaat
aaggctgctagagtgctttcaaaagtaattgcttctgcagtagctaatggaggattagac
gctaagaatgctgtaattatctcttgtagagttgatgcaggtcctgtgcttagacgctct
atgccaagagctaagggtagagccacagcgattagaaaacctacttcgcatgtgttggtg
gttgtagcagaggctaaagagtctgtgcagtcttctaagagcaataaaaaaacaaaagta
aaaggtgagtag

DBGET integrated database retrieval system