KEGG   Helicobacter cetorum MIT 00-7128: HCW_02420Help
Entry
HCW_02420         CDS       T02032                                 

Definition
(GenBank) Proline/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00250  Alanine, aspartate and glutamate metabolism
hce00330  Arginine and proline metabolism
hce01100  Metabolic pathways
hce01110  Biosynthesis of secondary metabolites
hce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HCW_02420
   00330 Arginine and proline metabolism
    HCW_02420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hce03000]
    HCW_02420
Enzymes [BR:hce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HCW_02420
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     HCW_02420
Transcription factors [BR:hce03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    HCW_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: AFI03765
UniProt: I0ELE6
Position
complement(501461..505012)
Genome map
AA seq 1183 aa AA seqDB search
MQKIIDDTLELARKLQNSISNNLSEQEKAFHSKMQKLLSNPENKVMLIELMDRSFRCEDN
KARFEMIEHVLDKYKSREIFSSFEKLLLMGFLSFGKMLPNMSVPFFVSKIRSDTKAMVLE
QEESKLKERILARKNEKITLNVNFIGEEVLGEEEANARFEKYSQALKSNYIQYISIKITT
IFSQINILDFEYSKKEIVKRLDALYALALEEEQKQGIPKFINLDMEEFRDLELTVESFME
SISKFDLNAGIVLQAYIPDSYEYLKKLHAFSKERVLKGLKPIKIRFVKGANMESEETIAS
VKDWELPTFSSKQDTDSNYNKMLDFILEDDNYKYIHIGTASHNIFEIAYVYTRIHAINDP
IALEHFTFEMLEGMSLQASLELKDMHKLILYAPVCDEAHFNNAIAYLVRRLDENTSSDNF
MKAFFNLKVDTKEWKDQEQRFLDSLKGIATLNNSTKRTQDRNAKQSGHTTYKNNSFKNES
DTDFILKANREWAKKVREKMYNAPILELYPEIDGRFENPNLTPLEVFDKIFHKKIASVHL
ADEEAILKALEVTKSDKSHFSQKSFEEIHALMSRTAQLFRERRGDLIGISALEVGKTFVE
TDAEVSEAIDFLEFYPYSLRVLQEQNKETQFAPKGVGVVIAPWNFPVGISVGTIAAPLAA
GNRVIYKPSSLSSVTGYKLCECFWDAGVPRDALIYLPAKGSDISKYLLKDESIKFAILTG
GEDTAYKMLEANPTLALSAETGGKNATIVSKMADRDQAIKNIVHSAFSNSGQKCSATSLL
VLEKEVYEDENFKKTLIDATLSLNVGDPFDFKNKIGTLADKPNEKVKKAMSELEKHEHYE
IPVSFVNDNPYLMKPSIKYGTKKGDFTHLTELFTPILSVMKAENLDDAIAIVNSTGYGLT
SALESLDEREWEHYLERIEAGNIYINKPTTGAIVLRQPFGGIKKSAVGFGRKVGIFNYIT
QFVDIHQEKEDDNILESNLSECLESLTKKGYDEHTHELNRAIFMAKSYAYHYKHEFSQAK
DYVKIRGEDNLFSYTKVKSVGYRITENDSLSDMLGIALACLIAQIPLTLSIENKQTNKNL
VFFLECLDALRMNAPIFYESLQEFSEKLSEFNRVRYLNHKLDLLHQKASSLGLVLATTKP
CLNGRFELLYYHLERSVSISYHRYGNLGSRALEQKTCHKSCCH
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcattgatgacacactagagttagctagaaaattgcaaaatagtatcagt
aataatctaagcgaacaagaaaaagcctttcattctaaaatgcaaaagcttttgagtaac
cccgaaaacaaggtcatgctcatagagcttatggataggagttttagatgtgaagataat
aaagctcgctttgaaatgattgagcatgttttagacaaatataaaagccgtgagattttt
tcttcctttgagaaactacttttaatgggatttttaagctttggaaaaatgctccccaat
atgagtgtgccattctttgtgagtaagattagaagcgacactaaagctatggtgttagag
caagaagaaagcaagctaaaagaacgcattttagctagaaaaaacgaaaaaatcactttg
aatgtgaattttattggcgaagaagttttgggcgaagaagaagccaacgcacgctttgaa
aaatactcacaggctttaaaatctaactacattcaatacatctccattaaaatcactacg
attttttctcaaatcaatatccttgattttgaatactccaaaaaagaaatagtcaaacgc
ttagacgctctttatgccctagctttagaagaagagcaaaagcaaggcattcccaaattt
atcaacttggatatggaagaatttagagacttagaactcacggtggagtcttttatggaa
agcatttctaagtttgatttgaatgcgggcattgtgttgcaagcctatattcctgattct
tatgaatacttgaaaaaactgcacgccttttctaaagaaagggttttaaaaggattaaaa
cccatcaaaattcgctttgttaagggagcgaatatggagagcgaagagaccattgcgtcc
gtaaaagactgggaactacctactttctctagtaagcaagataccgattctaactacaat
aaaatgctagattttattttagaagacgacaattataaatacattcacatcggcacagct
agtcataatatctttgaaatcgcttatgtatacacccgcattcatgcaatcaatgaccct
atcgcattagagcatttcacctttgaaatgctagaaggcatgagtttgcaagcaagccta
gaattaaaagatatgcacaaactcattttatacgctccagtctgtgatgaagcgcatttt
aacaatgcgattgcttacttggtgagaagattagatgagaacacatcaagtgataacttt
atgaaagctttcttcaatctcaaagtagacaccaaagaatggaaagaccaagaacagcgc
tttttagacagccttaagggcattgctactttaaacaattctacaaagagaacccaagat
agaaacgccaaacaaagtgggcataccacctataaaaacaattcatttaaaaacgaaagc
gatacggattttatcctaaaagccaacagagagtgggctaaaaaagtgcgtgagaaaatg
tataacgcccctattttggagctttacccagagattgatgggcgttttgaaaaccctaat
ctaacccccttagaagtctttgacaaaatcttccataaaaaaatcgcaagcgtgcatcta
gctgatgaagaggcgattttaaaagccttagaagtaaccaaaagcgataaaagccatttt
agtcaaaaaagttttgaagaaatccatgctttaatgagtagaaccgctcaactttttaga
gaaagaaggggcgatttaataggtatttctgctttagaagtgggtaaaacctttgtagaa
acggacgctgaagtgagtgaggcgattgatttcttagaattttatccttatagcttaaga
gtgttacaagagcaaaacaaagaaacacaattcgccccaaaaggtgtgggcgtagtgatt
gccccttggaattttcctgtaggcatttctgtaggcaccattgccgcccccctagcagct
ggaaatcgtgtgatttacaaaccatcaagtttatctagcgtaactggttacaaactttgt
gaatgcttttgggatgcgggtgtgcctcgagatgcactcatttacttacccgctaaaggg
agtgatattagcaagtatctcttaaaagatgagagcataaagtttgctattctcacaggg
ggcgaagacaccgcttataaaatgctagaagctaaccctactttagccttgagcgcagaa
accggtggtaaaaatgccaccattgtaagcaaaatggcagacagagaccaagccattaaa
aatattgtccattcagcctttagtaattccggacaaaaatgctccgccacttcgcttcta
gtgttagaaaaagaagtctatgaagatgaaaatttcaaaaagaccttaatagacgctact
ttgagtcttaatgtgggcgacccgtttgatttcaaaaataaaatcggcactctagcagat
aagcctaatgaaaaggtcaaaaaagcgatgagcgaattagaaaaacacgagcattatgaa
attcctgtttcttttgtgaatgataacccctatttgatgaaaccaagcataaaatatggc
accaaaaagggcgatttcacacacctaacagagctttttacccctatactatctgtaatg
aaagctgagaatttagatgatgccatagcgatagttaattccaccggctatggtcttacg
agtgcgttagagtctttagatgaaagggaatgggagcattatttagagcgtattgaagcg
ggtaatatttatatcaataagcctaccacaggagcgatagtcttacgccagccttttggg
gggattaaaaaatccgccgtagggtttggaagaaaggtagggatttttaactatatcacg
cagtttgtggatattcatcaagaaaaagaagatgataatattttagagagtaatttgagt
gaatgtctagagagcctaaccaaaaaaggctatgacgagcatacccatgaattaaatcgt
gcgatttttatggcaaaaagctatgcttaccattataagcatgaatttagtcaagccaaa
gattatgtcaaaattaggggcgaagacaatctcttttcttacactaaggttaaaagcgta
ggctatcgcattacagagaatgatagcctaagtgatatgctaggtattgctctagcgtgt
ttaatcgctcaaatccctttaactcttagtatagaaaacaagcaaacaaacaaaaatcta
gtctttttcttggaatgcctagacgctcttagaatgaatgcccctattttttatgaaagc
ttgcaagaatttagcgagaaactaagcgaatttaatcgggtgcgttatttgaatcacaaa
ctagatttattacaccaaaaagcgagttctttggggcttgtattagccactactaagcct
tgcttaaatgggcgttttgaattgctttattatcatttggagcgttcagtcagcatttcc
tatcatcgctatgggaatttaggctcaagagctttagaacaaaaaacgtgtcataaatca
tgctgtcattaa

DBGET integrated database retrieval system