KEGG   Helicobacter cetorum MIT 00-7128: HCW_03695Help
Entry
HCW_03695         CDS       T02032                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    HCW_03695
Enzymes [BR:hce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     HCW_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AFI04018
UniProt: I0EM49
Position
complement(771802..772605)
Genome map
AA seq 267 aa AA seqDB search
MNHTPNNQTNHMKGRTLVISGATRGIGKAILYRFAQNGVNVAFTYNKNVEEANKIIEEVE
QKYSIKAKAYPLNVLEPEQYTELFKQIDVDFDRVDFFISNAIIYGRSVVGGFAPFMRLKP
KGLNNIYTATVLAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYMPNYAGHGNSKNAVET
MIKYAATDLGEFNIRVNAVSGGPIDTDALKAFPDYAEIKEKVEEQSPLKRMGNPEDLAGA
AYFLCDEKQSAWLTGQTIVVDGGTTFK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacaccccaaacaaccaaactaaccatatgaaaggcagaacacttgttattagt
ggtgctacaagaggtattggtaaggctattttatatcgttttgcccaaaatggcgtgaat
gttgcttttacttacaataagaatgttgaagaggctaataaaatcatagaagaagtagag
caaaaatactctattaaagcaaaggcttaccctcttaatgtattagagcctgagcaatac
acggagcttttcaaacaaattgatgtggattttgatagagtagacttttttatatccaat
gccattatttatggacgctcggttgtagggggctttgctccttttatgcgcttaaagcct
aagggattgaataatatctatactgcaacggtgttggcttttgttgtgggggctcaagag
gctgcaaaacgcatgcaaaaaattggtggcggagcgattgtaagcttaagctctacaggc
aatcttgtttatatgcccaattatgctgggcatggcaattccaaaaatgctgtagaaacg
atgattaaatacgcagctactgatttaggtgaatttaatattagagtgaatgctgttagt
ggaggacccattgatactgatgccttaaaggcattccctgattatgcagaaattaaagaa
aaagtagaagagcaatctcctttaaaacgcatgggcaatcctgaagatttagctggagca
gcgtatttcttatgcgatgaaaaacagagcgcttggcttacaggacaaaccattgttgta
gatggtggaactacttttaaataa

DBGET integrated database retrieval system