KEGG   Helicobacter cetorum MIT 00-7128: HCW_07080Help
Entry
HCW_07080         CDS       T02032                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00900  Terpenoid backbone biosynthesis
hce01100  Metabolic pathways
hce01110  Biosynthesis of secondary metabolites
hce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HCW_07080
Enzymes [BR:hce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HCW_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: AFI04674
UniProt: I0EP05
Position
complement(1541948..1543048)
Genome map
AA seq 366 aa AA seqDB search
MIILGSTGSIGKNALKIATQFDIKIEALSCGRNIALLNEQIRIFKPKKVAILDAKDLSHL
EPLKAKVFVGLDGIDEMIEECSSSLVINAIVGVAGLKASFKSLQTHKRLALANKESLVSA
GHLLDVSKITPIDSEHFGLWALLQNKVLKPKSLIITASGGAFRDTPLELIPTQNVENALK
HPNWSMGAKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVECEDNSVIS
HLASADMKLPISYAINPKLACLNASIKPLDLSTLNAIKFEPIHTERYALWRYKDLLLENP
KLGVVLNASNEKAIEKFLNKEIAFGGLIKIISQTLELYAKKSLKLSSLEEVLRLDAEVRK
RSSEWF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgattattcttggtagcactggctctattggaaaaaacgccctaaaaatcgcaacgcaa
tttgatataaaaatagaggcgttaagctgtgggagaaatatcgctcttttaaatgaacaa
attaggattttcaagcctaagaaagtagcgattttagacgctaaagatttaagccactta
gagcctttgaaggctaaagtgtttgtagggctagatggcattgatgagatgatagaagaa
tgttcttctagcttggtaattaatgctattgtaggtgtggcaggattaaaagcaagtttt
aaaagcttacaaactcataaaagactagccctagcgaataaagaaagcttagtgagtgcg
gggcatttactagatgttagtaaaatcacgcccattgatagcgagcattttggcttgtgg
gcgttgttgcaaaacaaggttttaaagcccaaatccttaatcattaccgctagtgggggg
gcttttagagacactccattagaactcattcccacccaaaatgtagagaacgctcttaaa
caccctaattggagcatgggggcaaaaattacgattgattcagcaagcatggtcaataag
ctttttgaaatcttagaaacctattggctttttggggcttctttaaaaattgatgcgcta
attgagagaagttctatcgtgcatgccttggtggaatgtgaagataattctgtgatttcg
catttggcaagtgcggatatgaaactgcctattagctatgcaatcaaccccaaactagcc
tgtttgaacgcttctatcaagcctttggatttaagcactttaaacgccattaaatttgag
cctatccatacagagcgttatgctttatggcgttataaggatttgttgctagaaaaccca
aagcttggtgtggtgcttaatgcgagcaatgaaaaagcgatagaaaaatttttgaataaa
gaaattgcatttggaggtcttattaaaatcatctctcaaaccctagaattgtatgctaaa
aagtctctcaaactctctagcttagaagaagtgctaagattagatgctgaggtaagaaag
cgttctagcgagtggttttaa

DBGET integrated database retrieval system