KEGG   Helicobacter cetorum MIT 00-7128: HCW_07270Help
Entry
HCW_07270         CDS       T02032                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00770  Pantothenate and CoA biosynthesis
hce01100  Metabolic pathways
Module
hce_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HCW_07270
Enzymes [BR:hce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     HCW_07270
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     HCW_07270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AFI04712
UniProt: I0EP43
Position
1581533..1582810
Genome map
AA seq 425 aa AA seqDB search
MNFLDDLFYPLRLLENKRILLLVSGSIAVYKSLELVRLLFKSGANIQVAMSEDAKKFVTP
LSFEALSHNKVLHAQNEKWYYNHNNTLHHNHIACATNSDLLIFAPLSANSLAKIAYGIAD
NVVSATFLACNSPKILAPSMNTNMLLAKATQSNLKRLEEFGYIILETQNALLACDTKGNG
AMAEVLEILFKATQTLLKDTYFENREVIVIGGASIEKIDSVRTISNLSSGIQASTLALAL
YFKGAKVTFISSCFPTPLPKEITSIQVSDTKSYENALNNTTTNLRPHSQKPLLFNLAAIS
DYVPKTTFNHKLKKSELGECLNIECIQNKDLLASIDAKKFVKIGFKAEDKEDKAIENAKN
LLNSSQNHGKDCSMVALNLIKDNRPFGSLENELMLFTHHKTQNISSTNKLEASFKILDFI
KDNAL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttagatgatttattttaccccttaagattattagaaaacaaacgcatttta
ttgttagtgagtggctcaatcgctgtatataaatccctagaattagtgcgattattgttt
aaaagtggggcaaatattcaagtagcaatgagcgaagatgccaaaaagtttgtaaccccc
ttaagctttgaagccctaagtcataacaaagtcttgcatgcacagaatgaaaaatggtat
tacaaccacaacaataccttacatcataatcatatcgcttgtgctacaaactctgattta
ctcatctttgctcccttaagcgctaatagtttggcaaaaattgcttatggaatagctgat
aatgtagtaagcgcgacttttttagcttgtaacagccctaaaatcctagcccctagcatg
aacactaacatgttattagctaaagcaacccaaagcaacttaaaacgcttagaagagttt
ggttatattattttagaaacacaaaacgcccttttagcctgtgatactaaaggcaatgga
gcgatggctgaagttttagaaatcctttttaaagccacccaaacactcttaaaagacact
tattttgaaaatagagaagttatagtaataggcggagcgagtatagaaaagattgatagc
gttcgcactatcagtaacctttctagtggcattcaagcaagcactcttgctttggctttg
tattttaagggggcaaaagtaactttcatttcatcttgctttcctactcctttgcctaaa
gaaatcacaagcattcaagttagcgataccaaatcctatgaaaacgctttgaataatact
accacaaacctacgcccccattctcaaaagcccctactttttaatctcgctgccattagt
gattatgtgccaaaaacaacctttaatcataagcttaaaaaaagcgagctaggtgagtgc
ttgaatattgaatgcattcaaaataaagatttgctcgcatctatagacgctaagaaattt
gtcaaaatcggttttaaagccgaagataaagaagataaggccatagaaaacgctaaaaat
cttttaaactcatctcaaaatcatggtaaagactgctcaatggtcgctttaaatctcatt
aaagataatcgcccctttggttcattagaaaacgaattaatgctctttacgcaccataaa
acccaaaacatttcttccacaaacaaattagaagccagctttaaaatccttgactttatc
aaagacaacgccctttaa

DBGET integrated database retrieval system