KEGG   Helicobacter cetorum MIT 00-7128: HCW_08670Help
Entry
HCW_08670         CDS       T02032                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00010  Glycolysis / Gluconeogenesis
hce00020  Citrate cycle (TCA cycle)
hce00620  Pyruvate metabolism
hce00640  Propanoate metabolism
hce00650  Butanoate metabolism
hce00680  Methane metabolism
hce01100  Metabolic pathways
hce01120  Microbial metabolism in diverse environments
hce01130  Biosynthesis of antibiotics
hce01200  Carbon metabolism
Module
hce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCW_08670 (porD)
   00020 Citrate cycle (TCA cycle)
    HCW_08670 (porD)
   00620 Pyruvate metabolism
    HCW_08670 (porD)
   00640 Propanoate metabolism
    HCW_08670 (porD)
   00650 Butanoate metabolism
    HCW_08670 (porD)
  Energy metabolism
   00680 Methane metabolism
    HCW_08670 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCW_08670 (porD)
Enzymes [BR:hce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCW_08670 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_2 Fer4_6 Fer4_10 Fer4_9 Fer4_7 Fer4_15 Fer4_17 Fer4_16 Fer4_4 Fer4_8 Fer4_13 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AFI04989
UniProt: I0EPX0
Position
1916009..1916398
Genome map
AA seq 129 aa AA seqDB search
MKNWNEFEMGAVLFPFENNAQSEIEKHNTERNYTKESYFTTSVAHWRVAKPVHNENICIN
CFNCWVYCPDAAILSREGKLKGVDYTHCKGCGVCVSVCPTNPKSLWMFEEQEELDTALTK
WPTKQEKKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattggaatgaatttgaaatgggagcagtgcttttcccttttgaaaacaatgca
caaagcgaaatagaaaaacacaatactgagcgtaactacactaaagagagttatttcact
acttcagtagctcattggcgtgtagcaaagcctgtgcataatgaaaacatctgtattaat
tgctttaactgctgggtttattgccctgatgcagctattctttcaagagagggcaaatta
aaaggcgtagattatactcattgtaagggttgtggagtgtgtgtgagtgtttgccctact
aatcctaaatcactatggatgtttgaagagcaagaagaattagatacagcgcttactaaa
tggccaacaaagcaagaaaagaaaaaataa

DBGET integrated database retrieval system