KEGG   Hahella chejuensis: HCH_00788Help
Entry
HCH_00788         CDS       T00307                                 

Definition
(GenBank) Phosphate/sulphate Permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HCH_00788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Drf_FH3 DnaG_DnaB_bind Adaptin_binding DUF285
Motif
Other DBs
NCBI-ProteinID: ABC27684
UniProt: Q2SNU0
Position
783258..784826
Genome map
AA seq 522 aa AA seqDB search
MEFRNLGQLEEAASSGQQELARIGIALLFILGILIYTNLRIGDLEGGYLLVVAAMIGGYM
ALNIGANDVANNMGPAVGSKAITLLGALALAAIFEALGALVAGGNVVSTIKNGIINPDFI
QDSTTFIWLMMAALLAGALWLNVATYLGAPVSTTHSIVGGVLGAGIAAGGFGVANWGQMG
AIVASWVISPAMGGVIAAGTLYFVKRSMLYEEDKLGAARRYVPVLIAIMAWAFVTYLLLK
GAKNIIKLDFMTALLIGLGVSAALYFALLPMVGRAARKMENTRESVNKLFTVPLIFAAAL
LSFAHGANDVANAIGPLAAINDAIVNHGVVQKASIPLWVMMVGALGIAIGLLLYGPKLIK
TVGNEITELDKTRAFCIALAAAITVIVASQLGLPVSSTHIAVGAVFGVGFLREYLKVNYA
SQLHLILEEHAGLEREKLQKFLNNFEKASVEDMKQMLKQAKKHKEDVPLTKEERKRLKNV
YREELVKRASIKKIVAAWIITVPVSALLAALLYFMIRGMLLP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggagtttcgcaacctgggccagttggaagaagccgcctccagtgggcagcaggaactg
gcccgcattggtattgcgctactttttattctgggcatcctgatttacaccaaccttcgg
atcggcgatcttgagggaggatacctgcttgtagtcgccgctatgattggcggttatatg
gcgctgaacatcggcgccaacgacgtagccaataatatgggccccgctgtaggctcgaaa
gcgatcacgctgctgggcgcgctggcgctggcggcgatatttgaagcgctgggcgcgctg
gtcgccggaggcaacgtagtcagcactatcaagaatggcattatcaatcccgacttcatt
caagattccactactttcatttggctgatgatggcggcgctgctggccggcgcgttgtgg
ctgaacgtggcgacctatctgggcgcgccagtgtccaccacgcactctattgttggcggc
gtactgggcgcaggcatcgccgccggcggctttggcgttgcgaactggggacagatgggc
gctatcgtggccagctgggtgatttcgcctgcaatgggcggcgttatcgcggcgggaacc
ctgtacttcgtcaagcgttcaatgctgtatgaagaggacaagctgggcgccgcgcgtcgt
tacgttcctgtgcttatcgcgatcatggcgtgggcgttcgtaacttatctgttgctcaaa
ggcgccaagaatattatcaagctggatttcatgaccgccttgctgatcggtctgggagtc
tcggcggcgctgtactttgcgttgttgccgatggtgggacgcgctgcgcggaaaatggaa
aacacccgtgaaagcgtcaacaaactgtttaccgtaccgctgatctttgcggcggcgttg
ctgagtttcgctcatggcgccaacgacgtggctaacgcgattgggccgctggcggcgatc
aatgatgcgattgttaaccacggcgtggtgcaaaaggcgtctattccgttatgggtgatg
atggtcggcgcgctgggcatcgcgataggattgctgttatacggaccgaagttgatcaag
acggtcggcaatgaaattaccgagctggacaagacccgcgccttctgtatcgctctggcc
gctgctatcacggtaattgtggcttcgcagctgggcctgccggtcagctctactcatatt
gctgtcggcgcggtcttcggcgttggtttcctgcgtgaatatctgaaagtgaattacgcc
agccagctgcaccttattctggaggagcatgcgggtctggagcgagaaaagctgcagaaa
ttcctgaacaacttcgaaaaagcgtctgtggaagatatgaagcagatgctgaagcaggcc
aagaagcacaaagaagacgtgcctctcactaaagaggagcgcaagcgtctgaaaaatgtg
tatcgggaagagctggtcaagcgtgcgagcatcaagaagatcgtcgccgcctggattatt
actgttcctgtgtccgcattactggctgcgctgttgtactttatgattcgcggtatgctg
ctgccatag

DBGET integrated database retrieval system