KEGG   Hahella chejuensis: HCH_00857Help
Entry
HCH_00857         CDS       T00307                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hch  Hahella chejuensis
Pathway
hch00260  Glycine, serine and threonine metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCH_00857
Enzymes [BR:hch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     HCH_00857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABC27750
UniProt: Q2SNM4
Position
complement(854795..855802)
Genome map
AA seq 335 aa AA seqDB search
MIDFRSDTVTRPSQPMRAAMAAAEVGDDVYGDDPTVNRLQDIAAEMLGYEAALFACSGTQ
TNLLALLTHCQRGDEYLVGQQAHTYKYEGGGAAVLGGIQPQPIEHDADGTIPLAKIEAAI
KPDDFHFARTRLLSLENTIGGKVIPQDYIRNATELARRRGLATHLDGARLFNATVKQGIN
PKEVTQYFDSVSICLSKGLGAPVGSLLCGDKAFIDTARRWRKVCGGGMRQAGVLAAAGII
ALQSGVERLQEDHDNAAYLAQRLAETNLFDIDMSLVQTNMAFASYRGEDINALAQYLKSH
NILISPSPTIRFVTHLDISRDDIDRLAQAVMAFKK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttcgcagcgacaccgttactcgtcccagccagccgatgagagccgccatg
gcggccgcggaagtcggcgatgacgtctacggcgatgatccaaccgtcaaccgcctgcaa
gacatagcggcggagatgctgggctatgaagccgccttgttcgcctgcagcggcacccag
accaacctgctggcgttgctcacccactgccagcgcggcgatgagtatctggtcggccaa
caggcgcatacttataaatatgaaggcggcggcgcagcagtgctgggaggcatacaacct
caacccattgagcatgatgcggacggaactatccctctcgcaaaaatagaagccgccatc
aagccagacgacttccatttcgcccgcacccgcctgctgagcctggaaaataccatcggc
ggcaaggtgattccgcaagattacatccgaaacgcaacggagcttgcccgccgcagaggg
ctcgccacgcacctggacggagcccgtctgttcaatgcgaccgtcaagcaaggcattaat
cccaaagaagtcacgcaatacttcgactccgtctccatttgcctgtcaaagggcctcggc
gcgccagttgggtccctgttgtgcggcgacaaggcctttatcgataccgcccgacgctgg
cgaaaagtctgtggcggcggcatgcggcaggctggcgtattggccgccgctggcatcatt
gctttgcagtcaggggttgaacgcctgcaggaggaccacgacaacgccgcctatctggcg
caacgtctggcggagaccaacctgttcgatatagatatgagtctggtgcagaccaatatg
gcgttcgccagctatcgaggagaggatatcaacgcactggcgcagtatctgaagtcacat
aatattttaatttcgccatcgccaacgatccgattcgtcactcatctggatatttcacgg
gatgatattgatcgcctggcgcaagcggtcatggcgtttaaaaaataa

DBGET integrated database retrieval system