KEGG   Hahella chejuensis: HCH_01235Help
Entry
HCH_01235         CDS       T00307                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hch  Hahella chejuensis
Pathway
hch00010  Glycolysis / Gluconeogenesis
hch00051  Fructose and mannose metabolism
hch00562  Inositol phosphate metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01200  Carbon metabolism
hch01230  Biosynthesis of amino acids
Module
hch_M00002  Glycolysis, core module involving three-carbon compounds
hch_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCH_01235 (tpiA)
   00051 Fructose and mannose metabolism
    HCH_01235 (tpiA)
   00562 Inositol phosphate metabolism
    HCH_01235 (tpiA)
Enzymes [BR:hch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HCH_01235 (tpiA)
Exosome [BR:hch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HCH_01235 (tpiA)
  Exosomal proteins of bladder cancer cells
   HCH_01235 (tpiA)
  Exosomal proteins of melanoma cells
   HCH_01235 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Plant_all_beta
Motif
Other DBs
NCBI-ProteinID: ABC28107
UniProt: Q2SML7
Position
1248200..1248946
Genome map
AA seq 248 aa AA seqDB search
MRKKLIAGNWKSNGSLERNKALLEGIVNAKALGSVDVVVCPPFPYLQSVESAVSDSMIEL
GSQNCSATEDGAYTGEVSAKMCADMKCSWVILGHSERRALYAENDEVIACKVKRAVESGL
APILCVGETLADRESGRAEEVTLKQLDAVFMSVQPDDSWVVAYEPVWAIGTGKTASPEDA
QSMHKALRNNIRKHFPQIADKIRILYGGSVKSSNAKELFSMPDVDGALVGGASLVSEEFV
SIIEAAVE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaactgatcgccggaaactggaagtctaatggaagtcttgagcgtaataag
gctctattagaaggtatagttaacgctaaggcgttaggctcagttgatgtggtggtttgt
cctccatttccgtatcttcaaagtgttgagagtgcagtttctgattccatgattgagttg
gggtctcaaaattgctccgccactgaagatggcgcatataccggtgaggttagcgctaaa
atgtgcgctgatatgaagtgttcctgggtgatacttgggcattctgagcgcagggcgtta
tacgccgagaacgatgaagttatcgcttgtaaagttaagcgtgcagttgagtcgggattg
gctccgatactgtgtgtgggcgaaacgctggcggatcgcgagtcaggccgagctgaagaa
gttacgcttaagcagcttgatgctgtgtttatgtctgtccaacctgatgattcgtgggtt
gtggcgtacgagccggtatgggctataggcacgggtaaaactgcttcgccagaggatgcg
cagagtatgcataaagccttacggaacaatattcgtaagcattttccgcagatagcggat
aaaattagaattttgtatggcggcagcgttaagtcgtcaaacgcgaaagaactgttctca
atgccggatgtagatggggctctagttggtggcgcctcgttagtctcggaagaatttgtc
tctattatcgaggctgcggtagagtaa

DBGET integrated database retrieval system