KEGG   Hahella chejuensis: HCH_01874Help
Entry
HCH_01874         CDS       T00307                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hch  Hahella chejuensis
Brite
Enzymes [BR:hch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HCH_01874 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 DREV RrnaAD Methyltransf_32 NodS Methyltransf_12 MTS
Motif
Other DBs
NCBI-ProteinID: ABC28711
UniProt: Q2SKW3
Position
1909069..1909704
Genome map
AA seq 211 aa AA seqDB search
MTSRRTRLRLIERLRKNGIQNEAVLEAMTEIPRHIFVDEALAHRAYEDTALPIGHSQTIS
QPYIVARMTELLCSGWKPKRVLEVGAGSGYQTAILARLSTQVYTVERIAPLLEKAKLRFK
ALKLNNVSAKLSDGRWGWPEQGPFDAIMVTAAPEQTPSELLEQLADGGRLVIPVGSGSEQ
MLKVYKRQGAEIEESSLEQVRFVPLLGGVVR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcggcgtacgcgtctgcgtttgattgagcgcttgcggaaaaacggaattcag
aacgaagcggtgttggaggcgatgacggaaatccctcggcatatttttgtcgatgaggct
ctcgcgcatcgggcctatgaagataccgctctgccgatagggcattcccaaacgatctcg
cagccttatatcgtggctcgtatgactgaactgctgtgcagtggttggaagccgaaacgg
gtattggaagtgggcgctggctctggttatcaaaccgcgattctggcccggctgtctaca
caggtttataccgttgagcggattgcgccgctgctggaaaaagcgaaactgagattcaag
gcgctaaagttaaataacgttagcgccaaattatccgatgggcgttggggttggcctgaa
caggggcctttcgacgcaattatggtgactgcggctccggagcagacgccgtcggagttg
ctggagcaactggcggacggcgggcgtctcgtcattccggttggcagtggaagcgaacag
atgctgaaagtctacaaaaggcaaggcgcggaaatagaggagagcagtttggagcaggtt
cgatttgtgcctttattagggggcgttgttcgatag

DBGET integrated database retrieval system