KEGG   Hahella chejuensis: HCH_01891Help
Entry
HCH_01891         CDS       T00307                                 

Gene name
rnfD
Definition
(GenBank) predicted NADH:ubiquinone oxidoreductase, subunit RnfD
  KO
K03614  Na+-translocating ferredoxin:NAD+ oxidoreductase subunit D [EC:7.2.1.2]
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HCH_01891 (rnfD)
Enzymes [BR:hch01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.1  Linked to oxidoreductase reactions
    7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)
     HCH_01891 (rnfD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NQR2_RnfD_RnfE
Motif
Other DBs
NCBI-ProteinID: ABC28727
UniProt: Q2SKU7
Position
complement(1924206..1925246)
Genome map
AA seq 346 aa AA seqDB search
MAFLRITSPHLKGPARTTAIMQWVILATVPGLLTMTWFFGWGTLINVVLASLTAVAAEAF
VLTLRKRPLAFYLRDYSAVLTGVLLGLALPPYAPWWVTFVGTAFAIIFAKQIYGGLGNNP
FNPAMVGYALLLVSFPVAMTTNWATPRPLAEIPGFLEAFARIFWNADIGVDGYTMATPLD
TYKHEIVAGTAETVFALPVFGARTALGWEWVNLAFLAGGLLLIWRKIITWHIPVSMLAAL
ALCSLLLGWDEDKYAPLQLHLLAGATMLGAFFIATDPVSAATSKLGKLYYGAGVGILTYL
IRTWGNYPDAVAFAVLLMNFAAPFLDYYTQPRTYGHRKARRGVKQD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcttcgcatcacctccccccacttgaaaggccctgcgcgcaccaccgccatc
atgcagtgggtgatcctggccaccgtgcccggattgctgaccatgacctggttctttggc
tggggaaccctgatcaacgtcgtactggcttcattgaccgccgtggcggcggaggccttt
gtgctgacattgcgcaaacgacctctggccttttatctacgggattacagcgccgttctc
actggggtgctgctgggtcttgctttaccgccttacgctccatggtgggtgacattcgtc
gggacggcgttcgccatcattttcgccaaacagatttacggcggcctgggcaacaatccg
ttcaaccccgccatggtgggttacgcactgctgctggtgtcgtttccggtcgcaatgacc
actaactgggcgacgccccggcctctggcggaaattccaggcttcctggaagccttcgcg
cgcatcttttggaatgcggacatcggcgtggacggctacaccatggccactcccctggac
acttacaaacatgagatcgtcgccggcacagcagagacagtgttcgccctccccgtcttc
ggcgcgcgcacggcgctggggtgggagtgggtcaatctggcgtttctcgccggaggactg
ctgctcatctggcgcaagatcatcacctggcatatcccggtcagcatgctcgccgccctg
gcgctgtgctctctgctgctgggttgggacgaagataaatacgcgccgttgcaactgcat
ttactcgccggcgccaccatgctgggcgcgtttttcatcgccaccgacccggtttccgcc
gccaccagcaagcttggcaagctctattacggcgccggcgtcggtatactgacttacctg
atccgcacctggggcaactatccggacgccgtggcgttcgccgtattattgatgaacttc
gctgcgccgtttctggactactacactcaaccccgcacgtacggacatcgcaaagcccgt
cgcggcgtgaaacaggattag

DBGET integrated database retrieval system