KEGG   Hahella chejuensis: HCH_02436Help
Entry
HCH_02436         CDS       T00307                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hch  Hahella chejuensis
Pathway
hch00260  Glycine, serine and threonine metabolism
hch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01130  Biosynthesis of antibiotics
hch01230  Biosynthesis of amino acids
Module
hch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCH_02436 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCH_02436 (trpB1)
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCH_02436 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABC29243
UniProt: Q2SJD1
Position
2490399..2491631
Genome map
AA seq 410 aa AA seqDB search
MRYIVSTRFDAETLANIPDHRGHFGHYGGRFVSETLMSSLLELERHYEKLRIDPKFQEEF
DADLADYVGRPSPLYFAERLTKQVGGAKIYLKREDLNHTGAHKVNNTIGQALLAKYLGKP
RIIAETGAGQHGVATATVAARLGLKCVVYMGEEDVHRQSLNVYRMKLLGAEVRPVTSGTK
TLKDAMNEALRDWVTYVDDTFYIIGTVAGPHPYPKLVREFQSIIGREARLQCMEKEGRLP
DALVACVGGGSNAIGLFYPFIADEQIKMYGVEAGGLGLETGQHAAPLCAGRPGVLHGNRT
YLMEDENGQISATHSISAGLDYPGVGPEHAWLKDIKRADYVAATDEEALRAFHTLTRVEG
IMPALESSHAVAYAMKLAKTMDKDQIIIVNLSGRGDKDIHTVAKLDGIEI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtatatcgtgagtacgaggtttgatgctgaaacgctggccaatattccggaccat
cgcggccactttggtcattacggcggccgattcgtatccgagacgctcatgtcttcgctg
ttggagctggaacggcattacgaaaaactgcgtatcgaccccaagtttcaggaagagttc
gacgcggatctggctgattacgtaggccgaccttctcctttgtattttgcggagcgtctg
accaaacaggttggcggcgctaaaatttatctgaagcgggaagacctcaaccataccggc
gcccataaggtaaacaacaccattggtcaggcgttgctggcgaaatacctcggtaagccg
cgcatcatcgccgaaaccggcgcaggccagcatggcgtcgccacggcgaccgtcgcagcg
agactgggattgaagtgcgtggtctatatgggggaagaggatgtgcataggcagtctttg
aatgtctaccgcatgaagcttttaggcgctgaagtgcgccccgtcaccagcggcacgaag
accctcaaggatgcgatgaacgaagccctgcgggattgggtcacctacgtcgacgacact
ttctacatcattggtacggtggcgggtccgcacccttatcctaagctggtgcgggagttc
cagtccattattggccgcgaagcgcgcctgcagtgcatggagaaagaggggcggcttcca
gatgcactggtggcctgcgtgggcggtggctctaacgctatcggcttgttttatcctttc
atcgcggatgagcagatcaaaatgtacggcgttgaagccggcgggcttggcctggagacc
ggtcagcacgccgcgccgctttgcgcggggcgtcccggcgtattacatggcaaccgtact
tatctgatggaagatgaaaacggccagatttccgcgacgcattctatttccgcgggactc
gactacccgggcgtcggtcctgagcatgcctggctcaaagacatcaagcgcgcggattat
gttgcggcaactgacgaagaggcgctgcgcgcttttcataccctgactcgggtggagggc
attatgcctgcgctggaatccagtcatgcggtggcttacgccatgaagctcgccaagacc
atggataaagaccagatcattatcgtcaacttgtccgggcgcggcgataaagacatccat
actgtggccaagcttgacggaattgaaatttaa

DBGET integrated database retrieval system