KEGG   Hahella chejuensis: HCH_04006Help
Entry
HCH_04006         CDS       T00307                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hch  Hahella chejuensis
Pathway
hch00020  Citrate cycle (TCA cycle)
hch00620  Pyruvate metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01200  Carbon metabolism
Module
hch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCH_04006 (mqo)
   00620 Pyruvate metabolism
    HCH_04006 (mqo)
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HCH_04006 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABC30723
UniProt: Q2SF51
Position
complement(4143376..4144869)
Genome map
AA seq 497 aa AA seqDB search
MTVKKADVLLVGGGVMSTTLGTMLMQLDPSLNIVMVERLDHVAHESTYGWNNAGTGHAGY
CELNYTPETGDGDIEITRALAINASFEVSLQFWSYLVERGGLPSPDEFINTCPHESFVWG
ESDIAFLRKRHQLLSAHHLFKDMEFSDDPRTLQDWMPLVMEHRDPMQKVAATRVRYGSDV
DFGSLTRNMVEHLQKNANFELLLSHPVKSLKQTSDGRWNVQLSDSRNGGSKTIDAGFVFL
GAGGGALPLLQKSGIAEGDGYGGFPVSGQWLVCKKPDIVKRHYAKVYGKAAIGAPPMSVP
HLDTRIINGEPALLFGPYAGFTTKFLKTGSSFDLFGSIRANNFGPIMSVGINNMDLTRYL
IKEAMQSHSDRVKSLLNYFPEAKEDDWTLAEAGQRVQIIKRDAQGRGKLEFGTELVASKD
GTLAALLGASPGASVAVKAMVDVIERCFKDRLSSADWTAKLKEMIPSYGESLVDNAELLH
SVRSRTLSVLGLDKKRL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaaaaaggcggatgtgctgctagtcggcggcggtgttatgagcacgaccctt
gggacgatgctgatgcagttggacccatccttaaatatcgtcatggtggaaagactcgat
catgtcgcccacgaaagcacatatggctggaataacgcaggcacaggccacgctgggtac
tgtgagctgaactacaccccggaaaccggcgacggcgacattgaaatcacccgtgcgctg
gccattaacgcttctttcgaagtttcgctgcagttctggagttatctggtggagcgcggc
ggattgcccagccctgatgaattcatcaacacctgtccgcacgaaagcttcgtttggggc
gagtcggacatcgcgtttttgcgcaagcgtcaccaattattgagcgcgcatcatctgttc
aaagacatggagttcagcgacgatccccgcacgttgcaggattggatgccgctggtcatg
gaacatcgcgatccgatgcagaaagtagcggcgacgcgcgttcgctacggctccgatgtc
gacttcggctctctgacgcgcaacatggtggagcatctgcaaaagaacgccaactttgaa
ttgctgctgagccatccggtcaagagcctgaaacaaacgtcggacgggcgctggaacgta
caactgtccgacagtcgcaatggcggaagcaaaaccatcgacgctggattcgtctttctg
ggcgccggcggcggcgcgctgcccttgctgcagaaatccggcatcgcggaaggagacggc
tatggcggtttcccggtcagcggtcagtggctggtgtgcaagaagccggatatcgtcaaa
cgtcattacgccaaagtgtatggtaaagcggccatcggcgcgccgcccatgtctgtgccg
catttggacacccgcatcatcaacggcgaacctgcgctgctgttcggaccttacgccggt
ttcaccaccaagttcctgaaaacaggctcgtctttcgatctgttcggctccatccgcgcc
aataactttggtccgatcatgtctgtgggcatcaataacatggacttgacccgttacctg
atcaaagaggcgatgcagtcgcattcagaccgggtgaagtcgttgctgaactacttccct
gaagcgaaagaagacgactggacgctggcggaagccggacagcgcgtgcagattatcaag
cgggacgcgcagggccgcggtaagctggagttcggcactgagctggtggcttccaaagac
ggtacgctggcggcgctgttgggcgcttctcctggcgcatccgtggcggtgaaggcgatg
gtcgacgtgatcgaacgttgcttcaaagaccgtttaagcagcgcagactggacggccaag
ttgaaggagatgattccttcctacggcgagtcgctggtggataacgccgagttgctacac
agtgtgcgttccagaacgctgtctgtactgggtctggataaaaagcgtttataa

DBGET integrated database retrieval system