KEGG   Hahella chejuensis: HCH_04246Help
Entry
HCH_04246         CDS       T00307                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11902  type VI secretion system protein ImpA
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hch02044]
    HCH_04246
Secretion system [BR:hch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HCH_04246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N
Motif
Other DBs
NCBI-ProteinID: ABC30953
UniProt: Q2SEH1
Position
4389751..4391028
Genome map
AA seq 425 aa AA seqDB search
MASDNIIELEPFFSPISDENPSGTDLRDENDSDFSAAKAARRKVVSLAKAARFDANGELE
LVEQWREIRRLAPTILKRKSKDLEVAAWFTEALLKLEGFTGLRDGLQIIKGLVENFWDTI
YPLPDEDGVETRIYPLISLNGEDGTGTLVLPIKNTPLTDDTENVLTLTSYGRLQDALDIE
DPEERIRRFEELSLSEDIVNQQLLTVSPDKAQNVYEDIQEALALWQEIGELVDAKCAESG
SKASLPTSGVKNALQEVEELYKRLMKNKLLSDDEEAPIQTNDGQSGGNTGGGGGQQMRGG
VAHGPFRSREDAINHLLVVAEYFRKTEPHSPLCGAIERAASWGRMSIQELLMELIPDEEA
RARYALMTGIQIGEDAAPIGQLSQTARAVTIPEPKAKAEGASEPEQGTDNDWNNSGGGGS
GDSSW
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgacaatattattgagttagagcctttcttctcgccaatcagtgacgagaat
ccatccggaaccgacctaagagatgaaaacgacagtgacttcagcgccgccaaggccgca
cgtcgcaaagtcgtatctctggccaaggctgcgcgctttgacgccaacggtgaactggaa
ctggttgaacaatggcgggaaatccgtcgtctcgccccgacgattcttaaacgcaaaagc
aaagaccttgaagtcgccgcctggtttaccgaggcgttactgaaactggaaggcttcacc
ggacttcgcgacggccttcagatcattaaaggcttggtcgaaaacttttgggacactatc
tacccgcttcctgacgaagacggcgtggaaacccgcatttatccgctgatatcgctcaat
ggcgaagacggcacaggcaccctggtcctgccaatcaaaaatacgccgttgaccgacgac
acggaaaacgtgctgacgcttacctcttacggtcgccttcaggacgctctggatatcgaa
gatccggaagagcgcatccgtcgctttgaagagctgagtctcagtgaagatatcgttaac
cagcagctcctcactgtaagccctgacaaagcgcagaatgtatatgaagatattcaggaa
gcgctggcgttatggcaggagatcggagaactggtcgacgccaagtgcgcagaaagcggc
agcaaagccagcctccccaccagcggcgttaagaatgcgctgcaggaagtcgaggagctg
tataagcgactgatgaaaaacaagctgctttctgatgatgaagaagcgccgatacaaacc
aatgacggccaatcaggcgggaacactggcggtggaggcggtcagcaaatgagaggcggc
gttgcgcatggtcccttcagaagccgtgaagacgccatcaatcatctgttggtggtcgcc
gaatacttccgcaagacagaaccgcactcccccctctgcggagccattgaaagagccgcc
agctggggtagaatgtctattcaagaactgctcatggagctgatacctgacgaagaagcg
cgggcgcgctatgctttaatgacgggtattcaaattggcgaagacgcagctccgatcggc
cagttatcgcaaaccgcgagagcggtcaccattcctgagccaaaggcgaaagccgagggc
gcttccgagccggagcaaggcaccgacaacgattggaataacagcggtggcggaggaagc
ggcgacagtagttggtga

DBGET integrated database retrieval system