KEGG   Hahella chejuensis: HCH_04248Help
Entry
HCH_04248         CDS       T00307                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11900  type VI secretion system protein ImpC
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hch02044]
    HCH_04248
Secretion system [BR:hch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HCH_04248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ABC30955
UniProt: Q2SEG9
Position
4391641..4393134
Genome map
AA seq 497 aa AA seqDB search
MSDAELQGQESGAAEESSSSLLDMAITATKQTEPEQAQDLIANLAKQAGAGMVKWDRNLT
VTINKAIDQIDALMSKQLAAIMHEDKFQKLEGSWRGLHHLIMNSETSSSLKIRMLNIGKR
ELYKDLDKAVEFDQSQIFKKIYESEFGTAGGEPYGALIGDFEFSNHPEDIELLQNMAGVS
AAGFCPFISAAGPQMFGFDDFTELSTPRDLEKIFETQEYIPWRSFRDSDDSRFVTLVMPR
VLSRMPYGRNGKSIEDFNYEELPIDSKTGKAANVEHDKFAWMNAAYVMGTTLTQAFAEHG
WCVAIRGAENGGKVTGLPSHLFVSDDGDVDQKCPTEVGITERREAELSKQGFLPLLHYKN
TDYAVFFGSQTCQKAKKFDKADATANAAISARLPYIMATSRVAHYLKVMARDKIGSFMDA
KGAERWLNNWINTYCNSNPDASPESKAKYPLAEARVEVKENPESPGSFSAVAHLRPWLQM
EELTTSLRLVAEIPKSG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcagaattacaaggtcaggaatccggagcagcggaagagtccagttccagt
ctgctggatatggcgattaccgccaccaaacaaaccgagcctgaacaagcccaggacctg
atcgcaaacctggcgaaacaagcgggcgcaggtatggtcaaatgggaccgcaacctcacc
gtcactatcaataaagcgattgatcagattgatgcgttgatgtccaagcaattggcggcc
atcatgcacgaggacaaattccagaagctggaaggctcctggcgcggcctgcaccacctg
atcatgaattcagagaccagctcctcgctgaaaatccgcatgctgaacatcggcaagcgc
gagctgtacaaagatctggacaaagctgttgaatttgaccaaagccagatcttcaagaag
atctacgaatctgaattcggcaccgcaggcggcgagccttacggcgcgttgatcggcgac
ttcgagttctccaaccatccggaagatattgagttgctgcaaaacatggctggcgtttcc
gccgccggtttctgccctttcatttccgccgcaggcccacagatgttcggctttgacgac
ttcaccgaactctccacgcctcgcgatctggagaaaatatttgagacccaggaatacatc
ccctggcgcagcttccgggattccgacgactcccgtttcgtcaccctggttatgccccgc
gtactgtctcgcatgccttatggcagaaacggtaagtccatcgaagacttcaactacgaa
gagctgccgatcgactccaagactggcaaagccgctaacgtcgagcacgacaagtttgcg
tggatgaacgcggcttacgtcatgggcaccaccctgacccaggctttcgctgagcacggc
tggtgtgtggcgatccgcggcgcggagaatggcggtaaagtgactggcctgccttcccac
ttgttcgtcagcgatgacggcgacgttgaccagaagtgtccgacagaagtgggcatcacc
gagcgtcgtgaagcggaactgtccaaacaaggcttcctgcctctgttgcactacaagaat
accgactatgccgtattcttcggttcacagacctgccagaaggccaagaaattcgacaaa
gccgacgcgaccgccaacgcagcgatttccgcaagactgccttacatcatggctacctcg
cgcgtcgctcactacctgaaggtcatggctcgcgacaaaatcggttccttcatggacgcc
aaaggcgcagaacgctggttgaacaactggatcaacacctactgcaacagcaacccggac
gcatcgcccgaatccaaggcgaagtatccgttggctgaagcgcgcgttgaggttaaagag
aatccagaatctcctggttctttcagcgccgtcgctcacctgcgcccatggttgcaaatg
gaagagctcaccacttctttacgtctggttgcggaaattcctaagtctggttga

DBGET integrated database retrieval system