KEGG   Hahella chejuensis: HCH_04249Help
Entry
HCH_04249         CDS       T00307                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11899  type VI secretion system protein ImpD
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hch02044]
    HCH_04249
Secretion system [BR:hch02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   HCH_04249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ABC30956
UniProt: Q2SEG8
Position
4393264..4394772
Genome map
AA seq 502 aa AA seqDB search
MQNKVSPNDTPMPFTYGVAQKRTQGPSSAEVIALKKILQWIKLPDWCYEDKAAGKPLDYD
YLILWLQRAVAQIDNKIINQVNHILHHSKFQDLERAWRSLYDVVSYAYGRKLVKIRFLDI
TWSEITKDVNRSVEFDQSQLFHKIYSEEYDVPGGEPYGIIVMNFEVAHKPFAGHRFNDIP
TLERLAEIGAASFSPILLNAAPQLFEMNSFPEITSPISLKQLFSEQDYIAWNSLRDHPDT
RFLGLTIPRVLIRNPYSVQIAPHGGLLFSEKRAQASNENYLWGYANFALVKVLIREFTEV
GWFSHIRGLLRDHMAGGAVDNLVVDAFSTDAKKIAHKPIVDAVFSDERERALSEHGLIAL
CQCYDVPMGVFYSTPTLHRPKVFQDRIASANSRLSSLLQHVLCGSRFAHYIKVITRDMIG
SVRRAEDCERELQRWLTQYVTSQEDADWFMQARYPLREGSVQVREIPEKPGSFATTIYLR
PHYQADRLVSELHLTTEVNTAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataaagtatctccaaacgacacccccatgccgtttacctacggtgttgcgcag
aagcgcacgcaggggccgagctccgccgaagtcatcgcgctcaagaagatactgcaatgg
atcaagcttccagactggtgttacgaggacaaagccgctggtaagccactggattacgac
tacttgattctttggctgcaaagagccgtcgcccagatcgacaacaagatcatcaaccag
gtcaatcatattcttcatcacagcaagttccaggatttggagcgcgcatggcgcagcctg
tatgacgtagtgagctatgcatatggccgcaaactggtgaagatccgatttctggatatc
acttggtcggaaatcaccaaagacgtgaaccgctcagtggaattcgaccaaagtcagtta
ttccataagatatacagcgaagaatacgacgtgcccgggggcgaaccctacggcatcatc
gtgatgaattttgaggtggcccataaaccctttgcgggacaccgttttaacgatattcca
accttggagcgtctggctgaaatcggcgcggcctctttctcgccgatacttcttaacgcg
gcgccccaattgtttgaaatgaacagtttcccggaaatcaccagcccgatcagcctgaag
caactcttcagcgaacaggactacattgcctggaacagtctacgcgatcaccctgacaca
cgtttcctgggtctgactatcccccgggtgctgatccgcaatccctattccgttcaaatc
gccccacacggcgggctgcttttctcagaaaagcgcgctcaggcctccaatgaaaattat
ttatggggatacgccaactttgcgctggtcaaggtattgatacgcgaattcaccgaggta
ggttggttttcgcatattcgcggcttacttcgcgaccacatggcgggtggcgctgtcgat
aacctagtggtggatgcattctctacggacgccaagaagatcgcgcacaagccgattgtt
gacgccgtcttttccgacgagcgcgagcgtgcgctcagtgaacatggactcattgcgcta
tgccaatgctacgatgtccccatgggcgtgttttacagcaccccgaccctgcaccgacca
aaagtatttcaggacaggatcgccagcgccaactccaggctgtcttcattgctgcaacat
gttttgtgcggctcccgtttcgcccactatatcaaggtgatcacccgcgatatgatcggc
tccgtcaggcgggcggaagactgcgagcgcgaactgcagcgctggctgactcaatacgtg
acctcgcaggaggacgcggactggttcatgcaggcgcgctatccgttgcgtgaaggctcg
gtgcaagtcagagagattcctgagaagcccggctctttcgccaccactatttacttgcgt
ccgcactatcaggccgatcgtctggtatcggagctacatttgacgacagaggttaacacc
gctagttaa

DBGET integrated database retrieval system