KEGG   Hahella chejuensis: HCH_04298
Entry
HCH_04298         CDS       T00307                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11891  type VI secretion system protein ImpL
Organism
hch  Hahella chejuensis
Pathway
hch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HCH_04298
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hch02044]
    HCH_04298
Secretion system [BR:hch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HCH_04298
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C MMR_HSR1 Phage_holin_3_6 Sp38
Other DBs
NCBI-ProteinID: ABC31005
UniProt: Q2SEB9
Position
complement(4440744..4444202)
AA seq 1152 aa
MSRFFKWMIDPRFLTIVGLIALSLVIWFGADYVRFGEKAEPASGAVRLVVILCVWFVATI
IFLIKMLGQRKQNNSMVEAIQEEAKPSASDEEARVVGERFREAMSLLRTAKFDTKAGRRS
VYQLPWYIIIGPPGAGKTTALINSGLHFPLKEKLGLQQIGGVGGTRNCDWWFTDEAVLID
TAGRYTTQDSDAAQDRTGWRNFLALLKKHRMRRPINGVLLAVSVQDLLSSSEAERMQHAE
LIRNRIQELAENFQVRFPIYFLFTKADLISGFNEFFENLGATEREKVWGMTFPNTEDQNA
SQTAEYFAPEFEALVKRLNERVIWRAHQERDTRRRSKILAFPGQVENMRSVLDSFIKSVF
KTSRFEKQSLLRGVYFTSGTQEGRPIDRILANLSSNYGINYNVAANAPGAGKSFFLNKLL
KEVVFPEAEIATLNTRYEGHIKWSRRVAFITLLLAFGGALAAWTSSVVSTQNMMADIQEL
LNKHNQLASATPEPNEFEQVLDILKPLEDAQQLYSEVDHPWLSNLGLYDSGVVAETENTF
DASLRHFLTPLLRQRLEGVLVTEDNNDAIYEALRVYLMMGNSRVRDNNEIKTWFARYWEE
KLPGKASEQNALKTHLNQVLDSNFTDLSLKDTVVERSREKLRTIPIERRIYQQIKRQPEF
AGFLNLRDDLGVDFAGTFVVDSQVSSDLKIPRLYTKAGYGKLDLSPDSNLVKRYSSEQWI
LGAQVEEDFSEKDVENIVEKIKHLYFTDYIDVWSRALNSPKVVDFGSMDVARNKLANNLD
RTQSPILTLLTRASKETLLTPPLPDANVSGRTGQALDAAANLVAQQREPTPVDDAFKSLH
RLMEDKEIDRYWEKLRGIFDKLEETSLAPNSSEAAFKFALARFSGGEDPVKALRVTASRA
PSYLKGWLESMGDQSWKVLLGAGGSHLSAAWNREVYSVYQKTLAKNYPFSSRSSSDASLS
DFAAFFKPGGIEDSFVKANVAPFITSSWRAKGVDGRGIGISSQALQQMQVADSIRRVFFG
DKGEDPHVRFQVKPHKLDNTVRRFDFEVGSQRLRYTHGPQLKMSMDWPADKSGARVVFED
LNETLHTDAYEGDWGLFRLLDAHKVSKGSSSRLYNVMISVDHRNGEMELFASSTVNPFTP
GWIKRYDCPSSL
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgtcccgcttttttaaatggatgattgacccacggtttttgacgatagtgggacttata
gcgctttctctggtgatatggttcggggccgattacgtccgcttcggagaaaaagcagag
cccgcttccggggcggtcagactggtcgtcatactctgtgtctggtttgtcgccaccatt
atcttcttgataaaaatgctggggcaacgcaagcagaacaactccatggtggaggcgatt
caagaagaagccaagccttccgcatctgatgaggaagcgagagttgtcggcgagcgtttc
cgtgaggcgatgagtctgctgcgcaccgcgaagttcgacaccaaggcggggcgacgttct
gtctaccagttaccctggtatatcatcattgggccgccgggcgcaggtaagacgactgcg
ctgattaattccggcctgcactttccattgaaagaaaagctggggctgcagcaaattggc
ggcgttggcggtacccgtaactgcgattggtggtttacggatgaagcggtattgatcgat
acggccggtcgttacaccacccaggacagcgacgccgcccaggaccgcacgggctggcgt
aatttccttgcgctgctgaaaaaacatcgtatgcgcagaccgatcaacggcgtccttctg
gcggtgagcgttcaggatttactgagctccagcgaagccgagcgtatgcagcatgctgag
ctcattcgcaatcgaattcaggaactggctgagaattttcaggttcgcttccctatttat
ttcctcttcacgaaagcggatcttatttccggctttaatgagttctttgaaaatctcggc
gccactgagcgtgaaaaagtctgggggatgactttccctaatacagaggatcagaatgcg
tctcagacggcggagtactttgctcccgagtttgaagcattggtcaagcgattgaatgag
agagtgatttggcgggcgcatcaagagcgagacacccgccgccgttctaagattctcgct
ttcccagggcaagtggaaaacatgcgctcagtcctggatagctttatcaagtccgttttc
aaaaccagtcgtttcgaaaaacagtcgctgctccgcggcgtatatttcaccagtggcacc
caggaaggccgtccgatcgaccggattctggcgaacctgtcttccaactatggcatcaac
tataacgttgccgccaatgcgccgggcgcaggtaaaagtttcttcctgaacaagttgttg
aaagaggttgttttccctgaggcggaaatcgctacgcttaatacccgctacgaaggccat
ataaagtggtcgcgtcgcgtcgctttcatcaccctcctactcgcctttggcggcgcactt
gccgcgtggacttcaagtgtggtgagtacacagaacatgatggcggatattcaggaactg
ttgaacaagcacaatcagttggcgtcagcaactcctgagccgaatgaattcgagcaggtg
ctggatattttgaagccattggaagacgctcagcagctctattcggaagtggatcaccct
tggctgagcaatttggggctgtatgattccggcgttgttgcagaaactgaaaatactttt
gacgcctccttacgtcatttcctgacgccattgttgcgccagagattggaaggcgtgttg
gttacggaagacaacaatgacgccatatatgaagcgctgcgcgtttatctgatgatgggg
aacagccgggttcgcgataataatgaaatcaagacctggtttgcgcgttattgggaggag
aagcttcccggcaaggcttctgagcagaacgcgctgaaaacacatctgaaccaagtgctg
gacagcaactttacggatttgtctctgaaggatacggttgttgagcgtagccgggagaag
ctgagaactatcccgatcgagagacgtatttatcagcagatcaagcgccagcctgaattc
gcaggtttcctgaatttgcgcgacgacttgggcgtggactttgcgggtacgtttgtagtg
gattcgcaagtcagctcggacctgaagattccgcgtctgtacactaaagcaggatacggc
aagctggacctctctcccgattctaatctggtgaagcgttactcaagcgaacaatggatt
cttggcgcacaagtggaagaagacttctctgaaaaggatgttgagaacattgtagagaag
atcaagcatctctatttcaccgattatattgacgtttggagccgggcgctgaactctccc
aaagtggtcgacttcggctctatggatgtggcgcgcaacaagctggccaacaacctggat
cgtactcagtctccaatattgactctgttgactcgcgccagcaaagaaacgttgctaacg
ccaccgcttcctgacgcaaatgtcagtggacgcacaggccaggctttggatgcggccgct
aatctggtggcgcagcagcgtgagcctacgcccgtggatgatgctttcaagtcgctgcat
aggttgatggaagataaagaaattgaccgctattgggaaaaactgcgcggcatattcgac
aaattggaagagacatctcttgcaccaaactcatctgaggctgctttcaagttcgcactg
gcccgtttcagtggcggtgaagaccctgtcaaagcattgcgtgtcacggcatcaagagcg
ccaagctatctgaaaggatggttggagtcgatgggcgatcaaagctggaaagtgctgttg
ggcgcaggtggttcgcacttgagcgcggcctggaatagagaagtgtactctgtctaccag
aagacgttggctaaaaactacccattctcttccagatcatccagtgacgcttccctgagc
gactttgcggcgttctttaaacctggcggcattgaagacagtttcgtcaaggcgaacgtc
gcgccattcatcacttcatcctggcgcgccaagggcgtggatggtcgtggtattggcatc
agcagtcaagccttgcaacagatgcaggtggctgactctatccgccgtgtattctttggc
gacaaaggtgaagacccgcacgttcgtttccaggtaaaaccgcataaacttgataacacc
gtccgtcgtttcgacttcgaggtgggtagtcagcggttgcgatacactcatggtcctcag
ttgaaaatgagcatggactggccggcggacaagagtggcgcgagagtcgtcttcgaggac
ctgaacgaaactttgcacactgacgcctatgaaggagattggggactgttccgattattg
gacgctcataaggtgagcaaagggagttcttcccgtttatacaacgtgatgatcagtgtt
gaccatcgcaatggagaaatggagcttttcgccagcagtacggttaaccccttcacaccg
ggatggataaagcggtacgactgtccgagcagcttatag

DBGET integrated database retrieval system