KEGG   Hahella chejuensis: HCH_04299
Entry
HCH_04299         CDS       T00307                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11892  type VI secretion system protein ImpK
Organism
hch  Hahella chejuensis
Pathway
hch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HCH_04299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hch02044]
    HCH_04299
Secretion system [BR:hch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HCH_04299
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABC31006
UniProt: Q2SEB8
Position
complement(4444288..4445169)
AA seq 293 aa
MSNDSDKTFFGGAGGSDRTVIVPTPGGRSSGGLSTQPPPTAFAPHQAPTPPPSAVDGGQG
LDVKQGLNPLTASASELIALLGELRQTVQVQNPNQLRQQVIQQIRRFESEAQSKGVASDV
VLSARYVLCSALDEAIMNTPWGAEVGWSRATLLSTFHRENVGGEKVFLILDKILATPAKY
IDLIELIYVCLSLGFEGKYKLDPRGRDYLETIRDNLVRTIQMQRGEFDGDLSPRWRGATP
AKKRISEYVPLWVVASIMAAGLLLSYSGFRYWLGTVTDAQEQQLQELTQKYQS
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagcaacgattctgataaaacatttttcggcggcgctggcggcagtgatcgtacagtc
attgtacccacacccgggggccgctcttctggcggcctgtcgacacagcctccgccgacg
gcttttgcgccccatcaggcgccaactcctcctcctagcgccgttgacggcggacagggt
ttggatgttaagcaggggttaaaccctcttaccgccagcgcctcggagctgatcgcatta
ctgggagagttgcgtcagaccgtgcaggtgcaaaacccgaatcagctgcgccagcaggtt
atccaacagattcgccgttttgagtccgaagcgcagtcaaaaggggtggcctctgatgtc
gtgctatcggctcgctatgttttgtgctcggcgctggacgaagcgatcatgaacaccccc
tggggtgcggaggtcggctggtcgcgagcgacgcttctcagcacgtttcaccgtgagaac
gtgggcggtgagaaagtcttcctgattttggacaagatactggcgaccccggccaagtat
atcgacctcattgagctgatatacgtgtgtctgagcctgggctttgaggggaaatataag
ctggaccctcgtggcagggattatctggagaccattcgcgacaacttggtgcgtacaatt
cagatgcagcgaggcgagtttgacggggatctgtctcctcgttggcgtggcgccactcca
gctaaaaagcgtatttcggagtacgtgccgctgtgggttgtcgcgtccatcatggccgcg
ggactgttactgagttatagcggcttccgctattggctgggtacggtgaccgacgcgcag
gaacagcagcttcaggaactgacgcagaagtatcagtcttaa

DBGET integrated database retrieval system