KEGG   Hahella chejuensis: HCH_04300Help
Entry
HCH_04300         CDS       T00307                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11893  type VI secretion system protein ImpJ
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hch02044]
    HCH_04300
Secretion system [BR:hch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HCH_04300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABC31007
UniProt: Q2SEB7
Position
complement(4445274..4446611)
Genome map
AA seq 445 aa AA seqDB search
MSFENRVVWTEGMFLRPQHFQQQDRYHESLLEARCKPLKAFFWGFYDLEIDSQVLKLGKF
SINRCRGIFPDGTPFNVPDIDSELDILEPEKGLQNQTVYLGIPVKRPGSPDTHLEEDNQT
LVRFNARELETFDSTSEHSDSSKIQIGQLRFRILLEREDRSGYAVLPIARIQDKRDDGEI
VLDSQFIPPMLDVRAHPRMANLLQEVAGSLNLRAEALAGRLRDSGRQGTSEIADFLMLQM
INRVEPWLLHLAQIRPLHPVDVFGELMQIAGELATFTSVQRRPPATMPAYHHDELEKSIP
QLMQILNQYMNTVSETSAVSLDLVERRYGIYVSPITDRSLVEKATYILAVKAQMKSDQIR
SRFPSQVKIAPVERIRDLINAALPGIGLQALPVAPRQIPFHTGFTYFQLDRNSDYWRALA
QSSGFAVHIGADFPGLEMEFWAIRD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaaaaccgcgtcgtatggacggagggcatgttccttcgtccgcagcacttt
cagcaacaggaccgctatcatgagtcattgctcgaagcccgctgcaagcctctaaaggca
tttttttggggattttatgatctggagatcgacagccaggtgttgaagcttggaaagttc
tccatcaatcgctgcagaggtatttttcccgatggcacgccgttcaacgttccggatata
gattctgagcttgatattctggagcccgagaaagggctgcagaatcaaacggtttatcta
ggtattcctgttaagcgtccagggtcgcccgacacgcatctggaagaggacaatcagaca
ctggtgcgctttaacgcccgtgagctggaaacctttgactccacctccgaacatagcgac
agttccaaaatacagattgggcaactacgttttcgtatcctgctggaaagagaagatcgc
agtggttacgctgtattgcccatcgcgcggatacaggacaaacgggatgatggagaaata
gttctcgattctcagtttatcccgcccatgctggatgtaagagcgcatcctcgcatggcc
aacctgttgcaggaagtggccggcagcttgaatttacgcgcggaagcattggcgggccga
ttgagagacagcggcagacagggcacttccgagatcgcagacttcctgatgctgcagatg
attaaccgggttgagccctggttgttgcatttggcgcaaatccgcccgctacatcctgta
gacgtattcggcgagctaatgcagatagctggcgaattggcgacgttcaccagcgttcag
cgccggcctcccgcgaccatgccggcgtatcaccatgacgagctggaaaaatctatccca
cagttgatgcagattctgaatcagtacatgaatacggtaagcgagacctccgccgtatcc
ttggatctggttgagcgtcgctatggtatttatgtttctccaattacggaccggtcattg
gtggagaaggcgacttacatattggcggtcaaggcccagatgaagtcggatcagatccgc
agccgtttcccaagccaagtgaaaatcgcgccggtcgaacgtattcgcgacttgatcaat
gcggcgttgcctggcatcgggctgcaagccctgcctgtggcgccgagacaaattccattc
cataccggtttcacctacttccagttggatcgcaatagcgactactggcgagccttggcg
caatccagcggttttgccgtgcatatcggcgcggatttcccaggtttggaaatggagttt
tgggcaatcagggattaa

DBGET integrated database retrieval system