KEGG   Hahella chejuensis: HCH_04664
Entry
HCH_04664         CDS       T00307                                 
Name
(GenBank) ABC-type multidrug transport system, ATPase component
  KO
K25152  gliding motility-associated transport system ATP-binding protein
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hch02000]
    HCH_04664
Transporters [BR:hch02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Gliding motility-associated transporter
    HCH_04664
SSDB
Motif
Pfam: ABC_tran AAA_21 Zeta_toxin AAA_15 SMC_N AAA_23 AAA_16 AAA_30 AAA AAA_27 RsgA_GTPase AAA_14 DO-GTPase2 AAA_29 AAA_22 TsaE AAA_33
Other DBs
NCBI-ProteinID: ABC31363
UniProt: Q2SDB1
Position
4789243..4790190
AA seq 315 aa
MINVQNLSRHYGDFTAVNNVSFNIESGRIVGLLGHNGAGKTTIMKMLMGYLEPSSGNIRI
DGKDMREHSLALRADMGYLPENPPTYPEMTVVDYLDYAAQLRGTPADKRRQAVIEAVART
DLRDKALNPISTLSRGYRQRVGVAQAIINRPKILILDEPTNGLDPSQIQHMRDLITSLRS
HSTVILSTHIMQEVSAMCDRVLMIRHGELALDSSLAELQKSQRLLLRSSSGQAQIKSALA
DLGALQDIQPIATDGDTSTYALNTSLQHVDESFVSDVARKLVNANLPILALHPEVRDLET
VFKEVNQVAEVPHAA
NT seq 948 nt   +upstreamnt  +downstreamnt
atgatcaatgtccagaacctcagccgtcattacggcgacttcaccgccgtcaataacgtg
agtttcaatatcgaaagcggccgcatcgttggtctacttggccataacggcgccggtaaa
accactatcatgaaaatgctgatgggctatcttgaaccttcctcaggcaatatccgcatc
gacggcaaagacatgcgcgagcactcactcgcgctgcgcgccgatatgggatatctgccg
gagaatccgcccacttacccggaaatgactgtagtggattacctggactacgccgcgcag
ctaagaggaacgcccgcggacaagcgtcgccaggcggtgatcgaggccgtcgcccgcacc
gatttgcgggataaagcgctcaaccccatcagcaccttatcccggggatatcggcaacga
gtgggcgtcgcccaagccattatcaaccgccccaaaatcctgattctcgatgaacccacc
aacggccttgacccttcccagatacaacacatgcgcgacctcatcacctcgttgcgcagc
cattccacggtgatcctgtccacccacatcatgcaggaggtgagcgccatgtgcgatcgc
gtgctgatgatccgtcacggtgagctggcgctggattcctccctcgcggaactgcagaaa
tcacaacgtcttctgttgcgcagcagctccggacaggcgcaaataaaaagcgcactggcg
gatttaggcgcgttgcaggacattcaacccatcgccactgacggcgacacgtccacctac
gccctgaacacatcgctgcagcatgtggacgaaagcttcgtatccgacgtagcgcgcaaa
ctggttaacgccaacctgcctattctggcgctgcatccggaagtgcgcgatctggagaca
gtcttcaaagaagtgaatcaggtcgcggaggttcctcatgctgcctga

DBGET integrated database retrieval system