KEGG   Hahella chejuensis: HCH_04665
Entry
HCH_04665         CDS       T00307                                 
Name
(GenBank) ABC-type transport system involved in multi-copper enzyme maturation, permease component
  KO
K25151  gliding motility-associated transport system permease protein
K25153  gliding motility-associatede transport system auxiliary component
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hch02000]
    HCH_04665
Transporters [BR:hch02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Gliding motility-associated transporter
    HCH_04665
SSDB
Motif
Pfam: ABC_transp_aux ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_5 ABC2_membrane_3 DUF4350 DDOST_48kD CcmB DUF5687
Other DBs
NCBI-ProteinID: ABC31364
UniProt: Q2SDB0
Position
4790180..4793116
AA seq 978 aa
MLPDKNVLRMAGKEVSQFFSSPVAFVFLAAFLAVNLFIFFWVEAFFARNIADVRPLFEWM
PLLLIFLVAALTMRMWSDEKRMGTIEFLMTLPVTPLQLVLGKFIACFILLLIAMALTLPI
PITVSYLGHLDWGPVIGAYVAALCLGAAYLAIGLYVSAKNESQIVSLIITVLVCSLLYLL
GSDTLVDLFGYSTGEVLKQLGTGSRFESITRGVIDIRDLYYYLSLVGVFLALNVLALEKQ
RWANSDGARSHHRAWYAVSGLMIANLFAANLWLSEVKTLRADLTDGNLYSINDATRDYLS
QLQEPLLVRGYFSAKTHPLLAPLVPQLRDLIKEYEVAGGDKVRVEFVDPQSNPELEDEAN
NKYSIRPVPFQVSDKYQASLVNSYFNVLISYGDQFEVLGFRDLIEVKDRNESDLDVRLRN
PEYDITKAIKKVLYAYQSQGDLFATINTPVKLNGYVSSAQQLPPELQTLAQDLNDVLADI
KQESNGKFSYELQDPNAGDGSLAQQIQQDFGMQPMTTSLLSDDRFYFYLLMNDSKQYVQI
ALPDSLDKEGLKRNIESGLKRFSAGFTKTLALVVPESDADPYMQQFGQQSSPSFKTLRDK
LMETMTVKTIDLKDGLVPEDADILMLAAPESLSDKQLFAVDQFLMKGGTVLLSTSPYQTR
MTSSSLTAGKHTSGLETWLQNYGINLAQSMVLDPQNASFPIPVTRNVGGMSFREVRLLDY
PYFADIRDTGMNQDSAITSGLPNVTMSWASPIELDKEKTKALQVTELLRSSPQSWVSDKL
DVTPRVSADGHISPWTSEGEPESYLVGVALEGRFESSFKGKESPLLSEANNANEADQAPT
EGGQAAQQDDKAEKTHFGGVIDKSPESARIILFSSNEFLNDQTISLISSTERAPYLNSMQ
LVQNAVEWSLEDRSLLQIRSRSHFANTLYPMSAERQQFWEYLNYGLAIAGLALLYALFRL
WFNRRQSYYAGMLELGRA
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgctgcctgataaaaacgttctgcggatggccggcaaagaagtctctcagttcttctct
tcgccggtggcgtttgtattcctggccgcattcctggcggttaatctgtttattttcttc
tgggtggaagccttcttcgcccgcaacatcgccgacgtgcgccccctgtttgaatggatg
ccgctgctgctgatcttcctggtggcggcgctgaccatgcgcatgtggagtgatgaaaag
cgcatgggcaccattgagtttttgatgacgttgccggtaacgccattacaactggtgctg
ggcaagttcatcgcctgtttcattctattgctcatcgccatggcgctgaccttgccaatt
ccgattaccgtgtcttatctcggacatctggactggggaccggttatcggcgcctatgtg
gccgctctgtgtctcggcgcggcctacctcgccattggtctgtatgtcagcgccaagaac
gagtcccagatcgtcagtctgattatcaccgtactggtttgctcactgctgtatctgctg
ggctccgacacactggtggacctgttcggctactcaacgggggaagtcctcaaacaactg
ggaaccggctcccgttttgaatccatcacccgcggcgtcatcgacattcgcgatctgtat
tactacctcagcctggtcggcgtcttcctggcgttgaacgtgctggcgctggaaaaacaa
cgttgggccaacagcgacggcgcccgctcccatcatcgcgcctggtacgctgtttccggc
ctgatgatcgctaacctgttcgccgccaatctgtggctgagcgaagttaaaacgttgcgg
gcggatctcactgacggcaatttgtactccatcaacgacgccactcgcgattacttgagc
caactgcaggaaccgctgctggttcgcggctacttctccgccaaaacccatcctctgctg
gcgcctttggttccccagctacgggacctgatcaaagaatatgaagtggccggcggcgac
aaggtgcgggtggaattcgtcgatccgcaaagcaaccccgagctggaagacgaagccaac
aacaaatacagcatccgtccggtgcctttccaggtgtcggataaataccaggcgtcactg
gtgaattcctacttcaacgtgctgatcagctacggcgaccagttcgaagtactgggcttc
cgcgacctgatcgaagtgaaagatcgcaatgagtcggatctggacgtacgtctgcgcaat
ccggaatacgacatcaccaaagccatcaaaaaagtgctgtacgcctatcagagccagggc
gacctgttcgccaccattaacaccccggtaaaactaaatggttacgtctcctccgcgcag
cagttgccgccagaactgcaaaccctggcgcaggacctgaatgacgtactggcggacatt
aaacaggagtccaatggcaaattcagttatgaactgcaggacccgaacgcgggagacggc
tctctggcgcagcagattcagcaggatttcggcatgcagccgatgaccaccagcctgttg
tccgatgaccgcttctatttctacctgctgatgaacgacagcaagcagtacgtgcagatc
gccctgcccgactccctcgacaaagaaggcctcaagcgcaatatcgaaagcggcctgaag
cgcttctcggcgggcttcaccaagacactggcgctggtggttccggaaagcgacgccgat
ccttatatgcagcaattcggtcagcaaagttctcccagcttcaaaacgctgcgcgacaag
ctgatggaaaccatgaccgttaaaaccatcgacctgaaagacggtctggtcccggaagac
gccgatattcttatgctggcggcgccggagtcactgtctgacaagcagctgttcgccgtt
gaccagttcctgatgaaaggcggcacggtactgttgtccacttcgccgtaccaaacccgc
atgacctccagctccctcaccgcaggcaagcacacttccgggctggagacctggctgcag
aattacgggatcaatctcgctcagtccatggtgctcgacccgcagaacgccagcttcccc
attccggtcacccgcaatgtgggcggcatgtctttccgggaagtccggctgctggattac
ccctatttcgccgacattcgcgacaccggcatgaaccaggattcagcaatcacttccggt
ctgcctaacgtcaccatgagctgggcctcccccatcgagttggacaaggaaaaaaccaag
gcgctgcaggtcacagaactgctgcgctcctcaccgcaatcctgggtctccgacaagctg
gacgtcacgccccgcgtttccgccgacggccacatcagcccctggaccagcgaaggcgaa
ccggagtcctatctggtgggcgtcgcattggaagggcgctttgagtcctcattcaaaggc
aaggagtcccctctgctgagcgaagccaacaacgccaatgaagcggatcaggcgcccact
gaaggcggtcaggccgcccagcaagatgacaaagcggagaaaacccatttcggcggcgtg
attgataaatcgccggaatccgcgcgcatcattctgttctcctccaacgagttcctgaat
gaccagaccatcagcctgatcagctccaccgagcgggcgccttatctcaactccatgcaa
ctggtgcaaaacgccgtggaatggtcgttggaggatcgcagtctgctgcaaatccgctcc
cgcagccatttcgccaatacgctctaccccatgagcgcagagcgtcagcagttctgggag
tacctgaactatggactggcgatcgccggactggcgttgctgtatgcattgttccgctta
tggttcaaccgccggcagagctattacgccggcatgctggaattagggagggcttaa

DBGET integrated database retrieval system