KEGG   Hahella chejuensis: HCH_04756Help
Entry
HCH_04756         CDS       T00307                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
hch  Hahella chejuensis
Pathway
hch00071  Fatty acid degradation
hch00280  Valine, leucine and isoleucine degradation
hch00281  Geraniol degradation
hch00310  Lysine degradation
hch00362  Benzoate degradation
hch00380  Tryptophan metabolism
hch00410  beta-Alanine metabolism
hch00640  Propanoate metabolism
hch00650  Butanoate metabolism
hch00903  Limonene and pinene degradation
hch00930  Caprolactam degradation
hch01040  Biosynthesis of unsaturated fatty acids
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01200  Carbon metabolism
hch01212  Fatty acid metabolism
Module
hch_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HCH_04756
   00650 Butanoate metabolism
    HCH_04756
  Lipid metabolism
   00071 Fatty acid degradation
    HCH_04756
   01040 Biosynthesis of unsaturated fatty acids
    HCH_04756
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HCH_04756
   00310 Lysine degradation
    HCH_04756
   00380 Tryptophan metabolism
    HCH_04756
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HCH_04756
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HCH_04756
   00281 Geraniol degradation
    HCH_04756
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HCH_04756
   00930 Caprolactam degradation
    HCH_04756
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HCH_04756
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HCH_04756
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HCH_04756
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     HCH_04756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABC31452
UniProt: Q2SD22
Position
complement(4893470..4895617)
Genome map
AA seq 715 aa AA seqDB search
MIYAGKAITVKEIEDGIAVLTFDLQGESVNKFNRLTLTELAEATQKLQSQQGITGLVVTS
NKDCFIVGADITEFQELFAGSEEELVANNLEANKIFSAVEDLPFPTVTAINGIALGGGFE
MCLSTDFRVMSTSAKVGLPEVKLGIFPGFGGTVRLSRLVGADYAIEWICAGGEKRAEQAL
KEGAVDAAVAPEKLMDAALSVLRQAIEGKLDYKARREEKTGKLKLNPMESMMAFETAKGY
VAGQAGRNYPAPVEAIKVMQKHAGMTRDKAIEVEAKGFAKMAKTSVAHSLIGLFLNDQEL
KKKAKDLEPKAGAVKQAAVLGAGIMGGGVAYQSALKGTPILMKDINQSGIDLGLKEAKKL
LTKRVEKGRMNASEMADVLNRITPALSYGDFGTVDLVVEAVVENPKVKDIVLREVEDLVR
EDTILTSNTSTISINRLAQNLKRPENFCGMHFFNPVHMMPLVEVIRGEKTSEKAIATTVA
YAKAMGKTPIVVNDCPGFLVNRILFPYFGGFIGLVRDGADFQQVDKVMERFGWPMGPAYL
LDVVGMDTAKHAGDVMAEGFPDRMSYSETTIIDVMFDKGRYGQKSDKGFYAYELDKKGKQ
KKIVDDSVDALIKSVQKSQRDFSEEEIIERMMAPLCIETVRCLEDGIVETAAEADMGLIF
GIGFPPFRGGALRYIDSLGVEEFCKIADKYADLGALYHPTQGLRDMAKSGKKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgcaggtaaagccatcacagtcaaagagatcgaggatggtatcgcggtacta
actttcgatttgcaaggcgagtctgtaaataaatttaaccgcttgacgctgactgagttg
gcggaagcgacccagaaactacaaagtcagcaaggcattaccggccttgtcgttaccagc
aacaaagattgtttcatcgttggcgctgatatcactgaattccaggaattgttcgccggc
tctgaagaagagttggtcgccaacaacctggaagccaataagattttctccgctgttgaa
gatctgccattccccactgtgaccgccattaacggtatcgctctgggcggcggtttcgaa
atgtgtctctccactgacttccgcgtcatgtccaccagcgcgaaagttggcctgccggaa
gtaaaactggggatcttcccggggttcggcggaacagtacgtttatcccgtttggttggc
gccgattacgcaatcgaatggatctgcgccggcggcgagaagagagccgagcaggcgctg
aaagaaggcgctgtagatgcggcggtcgcgcctgaaaaactgatggacgcagcgttgtct
gtgttgcgtcaggcgatcgaaggcaagctggactacaaagcgcgccgggaagaaaaaacc
ggcaagctgaagctgaacccgatggaaagcatgatggcgtttgaaaccgccaaaggctac
gtggcgggccaggctggacgtaactatccggcgcctgttgaagccatcaaggtgatgcag
aagcatgcgggcatgactcgcgataaggcgatcgaagtggaagccaaaggcttcgcgaaa
atggcgaagacttctgtggcgcacagcttgatcggcttgtttctgaatgatcaggagctg
aagaagaaagcgaaagaccttgagcctaaagccggcgcagtcaaacaggcggcggtactg
ggcgcaggcatcatgggcggcggcgtggcgtaccagtctgcgctgaaaggcactcccatc
ctgatgaaggatattaatcagtccggtatcgatctgggtctgaaagaagccaagaaactg
ctgaccaagcgcgtcgaaaaaggccgcatgaatgcaagcgaaatggcggatgtgctgaat
cgcatcactcccgcgctgagctatggcgatttcggaaccgttgatctggtggttgaagcg
gttgttgaaaacccgaaggtcaaagatatcgtattgcgtgaagtggaagatctggtgcgt
gaggatactatcctgacctccaacacatctactatctccatcaatcgtctggcgcaaaat
ctgaagcgtccggaaaacttctgtggcatgcactttttcaatccggtgcacatgatgcct
ctggtggaagttatccgcggcgagaaaaccagtgaaaaagcaatcgccaccaccgtagcg
tacgccaaagcgatgggtaaaacgcctatcgtggtgaacgattgccctggattcctggtt
aaccgcatcctgttcccttacttcggcggatttattggtctggtgcgcgatggcgccgac
ttccagcaagtcgacaaagtgatggaacgcttcggctggccgatgggcccggcttacctg
cttgatgtggttggcatggacacggcgaagcacgctggcgacgtgatggcggaaggtttc
cctgatcgcatgagctattccgaaactaccattatcgacgtcatgttcgataaaggtcgt
tacggtcagaagagtgacaagggcttctacgcttacgagctggataagaaaggcaagcag
aagaaaattgtcgatgacagcgttgacgcactgattaagtccgtgcagaagtctcagcgc
gacttctctgaagaggaaatcatcgagcgcatgatggcgcctttgtgcatcgaaaccgtt
cgctgcctggaagacggtatcgtcgagactgcggcggaagcggatatgggcttgatcttc
ggcatcggtttccctccgttccgtggaggcgcgttgcgctacattgactctctgggcgtg
gaagagttttgcaagatcgctgacaaatatgcggatctgggcgctctgtatcatccgacc
caagggctgcgcgacatggctaagtccggcaagaagttttttggctaa

DBGET integrated database retrieval system