KEGG   Hahella chejuensis: HCH_04831Help
Entry
HCH_04831         CDS       T00307                                 

Definition
(GenBank) Glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hch  Hahella chejuensis
Pathway
hch00860  Porphyrin and chlorophyll metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
Module
hch_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCH_04831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hch01007]
    HCH_04831
Enzymes [BR:hch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HCH_04831
Amino acid related enzymes [BR:hch01007]
 Aminotransferase (transaminase)
  Class III
   HCH_04831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABC31525
UniProt: Q2SCU9
Position
complement(4975660..4976976)
Genome map
AA seq 438 aa AA seqDB search
MSDYQSRLLNVIPGGAHTYSRGFDQFPANAPQILASGKGAYVFDPDNKRYLDYGMALRSV
ILGYADEAVSLAAIEQIWAGNNLTRASIVELEAAELLVDMIDAVDMVKFTKNGSTAVSAA
VKLARAYTGRDLIARCGQHPFFSYDDWFIGSTPLTRGIPQNVVEQTKCFNYNDLASLEQL
FAAYPQQIACVVMEPATTEHPAPSATHEGETFLHDVQRLCARHGAVFVLDEMITGFRWDL
RGAQHKYRIKPDLCTFGKAMANGFSVAAVAGRRDIMELGSIEKSGAERLFLLSTTHGAEM
CGLGAFVKTAAMLRERDVVNHIWSYGARLKSGMNALAAEAGVADYFRVEGIDCSPGYLTL
DRDGNPSMALRTLFSQEMVRQGVLMPWIALCREHGEEELEQTLSAVKSALRVYAQALESG
WENFLEGPVIKPVFRKYN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattatcaaagccgattattgaatgtcattcccggcggggcgcacacttactcc
cgaggttttgaccagtttcccgctaatgcgccgcagattcttgcctccggcaaaggcgct
tatgtatttgacccggacaataagcgttatcttgattacgggatggcgttgcgttcggtg
attctggggtatgcggatgaagcggtgagtctggccgccattgagcaaatctgggccggc
aataatctcacacgggcgtcaatcgtagagctggaggcggctgaactgctggtggacatg
atcgacgccgtggatatggtcaagttcaccaaaaatggctccaccgctgtgtcggcggcg
gtgaaattggcgcgcgcctataccgggcgtgatctgattgcgcgctgcggtcagcatcca
tttttttcctatgatgactggtttatcggctctactcctttgacgcgaggtattccacag
aatgtggtggagcagaccaagtgctttaactacaacgatctggcgtcactggagcaactt
ttcgccgcgtatccgcaacaaatcgcctgtgtcgtcatggagcccgcgacaacggagcat
cctgcgccgtcggctactcacgagggagaaacctttctgcatgatgtgcagcgcctgtgc
gcgcgtcatggcgccgtctttgtccttgatgaaatgattacggggtttcgctgggacctg
cgtggggcgcagcataaatatcgcattaagccggacctgtgcacgtttggcaaagccatg
gccaacggcttttcggtggcggcggtggccggacgcagagatatcatggagctgggctct
attgaaaagagcggggcggagcgcttgtttttgttatccacgacccatggcgcggaaatg
tgcggactgggggctttcgtgaaaacggcggccatgttgcgggagcgcgatgtcgttaat
catatctggtcatacggggccagactgaagtccggtatgaacgccctggcggcggaagcg
ggagtggcggattactttcgtgtggaaggcatagactgttcaccgggttatctgacgctg
gatcgtgatggaaatccttcgatggcgctgcgcacgctattcagccaggaaatggtccgg
cagggtgtactgatgccatggatcgccttgtgtcgggaacatggcgaagaagaactggag
caaaccttaagtgcggttaaaagcgcattgagggtatacgcgcaagcgctggagtccgga
tgggagaactttctggaagggcccgtcatcaaacctgtttttcgcaaatataactga

DBGET integrated database retrieval system