KEGG   Hahella chejuensis: HCH_05299Help
Entry
HCH_05299         CDS       T00307                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hch  Hahella chejuensis
Pathway
hch00071  Fatty acid degradation
hch00072  Synthesis and degradation of ketone bodies
hch00280  Valine, leucine and isoleucine degradation
hch00310  Lysine degradation
hch00362  Benzoate degradation
hch00380  Tryptophan metabolism
hch00620  Pyruvate metabolism
hch00630  Glyoxylate and dicarboxylate metabolism
hch00640  Propanoate metabolism
hch00650  Butanoate metabolism
hch00900  Terpenoid backbone biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01200  Carbon metabolism
hch01212  Fatty acid metabolism
hch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HCH_05299
   00630 Glyoxylate and dicarboxylate metabolism
    HCH_05299
   00640 Propanoate metabolism
    HCH_05299
   00650 Butanoate metabolism
    HCH_05299
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HCH_05299
   00072 Synthesis and degradation of ketone bodies
    HCH_05299
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HCH_05299
   00310 Lysine degradation
    HCH_05299
   00380 Tryptophan metabolism
    HCH_05299
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HCH_05299
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HCH_05299
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HCH_05299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hch04147]
    HCH_05299
Enzymes [BR:hch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HCH_05299
Exosome [BR:hch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCH_05299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5417
Motif
Other DBs
NCBI-ProteinID: ABC31972
UniProt: Q2SBK2
Position
5442585..5443766
Genome map
AA seq 393 aa AA seqDB search
MNAREVVIVSGARTPMGGFQGSLSSLTAVELAAASIKEAISRANLQPDDIQEVIMGCVLP
AGLKQGPARQAMLDAGIPNSTGATTINKLCGSGMKATMLAHDLIVAGTNQVMIAGGMESM
SNAPYLLPKARSGYRMGHGEVKDHMFLDGLEDAKTGRLMGSFAEEVAGKFGITRERMDDF
AIRSLKLAQEAIETGALKDEIVPVTVSTRKGDVLVEHDEQPGAANLEKIPTLRPAFQKDG
SITAANSSSISDGASAMVLMSREEADRRGAKPFARIVAHSTHSQAPSEFTIAPIGAIQKV
LQKAGWSKDEVDLFEINEAFAMVTMLAIQELGLDGEKVNVFGGACAQGHPVGSTGSRIII
TLMHALKRLGKKRGVAALCIGGGEATAVAIELV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgagagaggtcgtaattgtgtctggagccagaacgccaatgggcggttttcag
ggctccctgagttcattgacggctgtggaactggctgcggcgtctattaaagaagccata
tcccgcgccaacctgcagcctgacgacatacaggaagtcatcatgggctgcgttcttccc
gcaggcttgaagcaaggccccgcgagacaggcgatgctggatgcgggcatccccaattct
actggcgccaccaccatcaacaagttgtgcggctccggcatgaaagccacgatgctggcg
catgacctgatcgtcgcagggaccaatcaagtcatgattgccggcggtatggagagtatg
agcaatgcgccttacttgttgccaaaggcgcgctcaggctaccgcatgggccacggcgaa
gtaaaagaccacatgttcctcgacggattggaagacgccaaaaccgggcgcctgatgggt
tcattcgctgaggaagtcgccggtaaattcggcatcacccgcgaacgtatggacgatttc
gccatcagatcgttaaagcttgcccaggaagcgattgaaaccggcgcgctgaaggacgaa
attgttcctgtcacagtgtcgacgcgtaagggagatgtcttagtagagcatgacgagcag
ccaggcgcagccaatcttgaaaagatccccacgctgagacccgcattccaaaaagatggc
tccatcaccgcagctaactccagctccatctccgacggcgcttccgctatggttttaatg
agtcgtgaggaggctgaccggcgcggcgcgaagcctttcgccagaatcgtcgctcacagc
acgcactcccaggcgccctcagagttcaccatcgcgcctatcggcgccattcaaaaagta
ctacagaaagcgggctggtctaaggacgaagtcgatctgtttgaaatcaatgaagctttc
gccatggtgacaatgcttgcgattcaagagctgggcttggacggagagaaagtcaatgta
ttcggcggggcctgcgcccagggacaccccgttggctcaaccggctcgagaatcattatt
accctgatgcatgcgttgaagcgtctcggcaagaagcgtggcgtagcggcgctctgtatc
ggcggcggcgaagcaactgctgtcgccattgagcttgtctaa

DBGET integrated database retrieval system