KEGG   Hahella chejuensis: HCH_05780Help
Entry
HCH_05780         CDS       T00307                                 

Definition
(GenBank) Pseudouridylate synthases, 23S RNA-specific
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hch03016]
    HCH_05780
Enzymes [BR:hch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     HCH_05780
Transfer RNA biogenesis [BR:hch03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    HCH_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABC32431
UniProt: Q2SA93
Position
complement(5896367..5897113)
Genome map
AA seq 248 aa AA seqDB search
MIPLSILYQDEWLVAIDKPSGLLVHRSEIDRHETLFAIQLLRDQIGRRVYPLHRLDKPTS
GVLMFALDSDTAKKCGESWETGVDKAYLAIVRGVPAEEGVIDKPLKEPWDRLGDRNVSKD
KPEQPAVTHYQRLAECELPYAVDRYPTSRYALLKVRPQTGRRHQIRRHFKSLSHPLIGDT
SYGKGVHNRFFAEQFGVQRLLLHAAEMRLPHPCSGETLTVCAPVTGEMRRLLETLDWLNS
IPLAWRKI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgatcccgcttagcattctttatcaagacgaatggctcgtcgccatcgacaaaccttcc
ggccttttagtgcatcgtagtgaaatcgatcgccacgaaaccctgtttgcaattcaactt
ctgcgcgaccagattggacgcagggtatatccgttgcatcgactggataaaccgacgtcc
ggcgttctcatgtttgcgctggattccgatacggcgaagaaatgcggagagtcctgggaa
accggcgttgataaagcctatctggcgatagtgcgtggcgtccccgctgaagagggcgtg
atagacaagccattaaaggagccctgggatcgcctgggcgatcgtaacgtcagcaaggac
aaaccggaacaaccggcggtaacgcattatcaacgtttggcggagtgcgagttgccctat
gcggtggaccgttatcctacctcgcgttacgccttgctcaaggtgcgcccgcaaaccgga
agacggcatcagattcgccgccacttcaagtcgctgtcgcatcccttgataggcgacacc
agttacggaaagggcgtgcataatcgctttttcgccgagcaattcggcgtgcagcgacta
ctattgcatgcggcggaaatgcgtttgccccatccctgcagcggcgagactttgaccgtc
tgcgcgccggtgacgggagaaatgcggcgactgctggaaacgctggattggttaaattcg
atacctttggcgtggcgaaaaatttaa

DBGET integrated database retrieval system