KEGG   Candidatus Hodgkinia cicadicola Dsem: HCDSEM_030Help
Entry
HCDSEM_030        CDS       T00938                                 

Gene name
metF
Definition
(GenBank) putative 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
hci  Candidatus Hodgkinia cicadicola Dsem
Pathway
hci00670  One carbon pool by folate
hci01100  Metabolic pathways
hci01120  Microbial metabolism in diverse environments
hci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HCDSEM_030 (metF)
Enzymes [BR:hci01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     HCDSEM_030 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ACT34219
UniProt: C6UMW9
Position
24555..25445
Genome map
AA seq 296 aa AA seqDB search
MASCAFRCFYSLRSRRVALSLELFSFRSARAAERTLAACCLPPSRPKLIATTCGAGGGCK
LGFVRTLACVVKLVPSRSLLAHLLISSGFDLFAHRSLLALSQVGVSSVLGLRGDQFAASQ
LRPDGVCGLAMLEAAKLASFAHAGASYPNVHALGSSFKACLTAVLAKRVAGCSTLFTQLV
SDLASCLKAGCKLATSASSTLVAGVLAPSRARAGCRLMMACGSYISYDLKRVVGTISRRL
SLMRLACCLATLAALNLQFVHAFVLNRPRLAVEAWWLLAGASLMLKLTPKLAVITT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggctagctgcgcgtttcgctgcttctacagcttgcgctctaggcgcgtcgcgctgtcg
ctcgagctgttttcgtttaggtcagcgcgcgccgctgagcgcacgctagccgcgtgctgc
ttgcccccaagccgacctaagctgatagctacaacctgtggagccggcggcggctgcaag
cttggcttcgtgagaacgctagcttgcgtcgtcaagcttgtgccctcgcgttcgctgctt
gcccacctgctgatttcgtctgggtttgatttgtttgcccaccgctcgctgctcgcgctg
tcgcaagttggcgtgtccagcgttttggggcttaggggtgatcagtttgctgcgagccag
cttaggcctgacggcgtctgtgggcttgctatgctcgaagctgctaagctggcttcattt
gcacacgctggcgctagctatcctaacgtacacgcgctcggttcgagctttaaagcttgc
ttaactgcggtgctagctaagcgtgtggcaggttgctcgacgctgttcacgcagcttgtt
tctgatttggcttcctgtttaaaagctggctgcaagctagctacaagcgccagctcaact
ttggtagctggcgtgctcgcgccatcgagggcacgcgccggctgccggctgatgatggct
tgtggctcctacataagctatgacctcaaacgcgtcgttggcacaatcagcagacggcta
tcgctaatgcgtttggcttgttgcttggcgacgcttgcggcactaaaccttcagtttgtg
cacgcgtttgtgcttaaccgcccgaggcttgcagttgaagcgtgatggctgctggctggc
gctagcttgatgctaaagttgacgcctaagctagccgtcataaccacttag

DBGET integrated database retrieval system