KEGG   Helicobacter cetorum MIT 99-5656: HCD_02335Help
Entry
HCD_02335         CDS       T02033                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hcm01100  Metabolic pathways
hcm01110  Biosynthesis of secondary metabolites
hcm01130  Biosynthesis of antibiotics
hcm01230  Biosynthesis of amino acids
Module
hcm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCD_02335
Enzymes [BR:hcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HCD_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFI05487
UniProt: I0ERB8
Position
complement(490986..491540)
Genome map
AA seq 184 aa AA seqDB search
MQEIKILENLQKSLTLKESMLSYEMLGKSLSYNPYLPRAISKTKDYVFLTPGEIREKLLN
ESIDTECVIVNFKKLYEVGVPSVFDLEILGLLRRHASSFIIHDDFLMSHYQLLESVIQGS
DGVILDEMLLKEDLKDMIEFALRLGLSVFVETKKASESLKALGVLAVLEKAPNSQNKKKI
VFLD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaagattttagaaaatttacaaaaaagcttgaccttaaaagagagcatg
ctctcttatgagatgttaggcaaaagcttgtcgtataatccttacttacctagagccatc
tctaaaactaaggactatgtttttttgacccctggtgagattagagaaaagcttttaaat
gaatctatagacacagaatgtgtcattgtcaattttaaaaaattgtatgaagtgggtgtg
ccaagcgtatttgatttagaaatcttagggttattacgccgtcatgcaagctcttttatt
atccatgatgattttctaatgagccattaccagcttttagaatccgttattcaaggttct
gatggggttattttagatgaaatgcttttaaaagaagatttgaaagatatgatagaattt
gctttgcgtttggggctaagcgtttttgtagagactaaaaaggctagtgaaagcttaaaa
gcgttaggggttttagctgtgttagaaaaagctccaaattctcaaaataagaaaaaaata
gtctttttagattga

DBGET integrated database retrieval system