KEGG   Helicobacter pylori HUP-B14: HPB14_00480Help
Entry
HPB14_00480       CDS       T02035                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00260  Glycine, serine and threonine metabolism
hcn00750  Vitamin B6 metabolism
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
hcn01120  Microbial metabolism in diverse environments
hcn01230  Biosynthesis of amino acids
Module
hcn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPB14_00480
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPB14_00480
Enzymes [BR:hcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPB14_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFI06814
UniProt: I0EV45
Position
complement(95533..96987)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTDALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGVSGDFDDAQNALKNLLKDDDFNEALKTHQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAQKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERALFSLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
STTLLALNEQKKDDKTALETLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILLWL
ESLH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgcccccaaaggcgggctttacactttagagcgttttgaaacgctagaa
tggcaagattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattgacagacgctttaaaacgctatgaaaattttgat
aaccctaaaaacccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaacctagcggtagggaaaaatgaaaagtatttaatgctcgtttctacaagcggggat
accggccctgcgactttagaaagtctggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttggggtgagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaagccctaaaaacgcaccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccataccc
agcggtaattttgggaacgctttaggggcgttttacgctcaaaaaatgggcttgaatatc
gctaaaatcaaggtcgtaaccaacagcaatgatgttttaagggagtttatagagacaggc
cgttacgatttaacccaccgctctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaacgtggaaagggcgctttttagcctttttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgccttaaagcctaaagaattagccctt
ttacaggagcatttttcttgtgcgagctgctcagatgaagcctgtttgaaaaccattcaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaacccacgaaaaaacccttgtttccgccaccgcttcttatgaaaaattccct
agcaccacccttttagccctgaatgagcaaaaaaaagacgataaaaccgccctagaaacg
cttaaaaacagctacaataccccagatagccagcgccttgatgatttatttgaaagaggg
atcaagcaccaagaagttttaaaactcaatgagatcaaatcttctattcttttgtggtta
gaaagcctacattaa

DBGET integrated database retrieval system