KEGG   Helicobacter pylori HUP-B14: HPB14_00960Help
Entry
HPB14_00960       CDS       T02035                                 

Gene name
ndk
Definition
(GenBank) mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00230  Purine metabolism
hcn00240  Pyrimidine metabolism
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
hcn01130  Biosynthesis of antibiotics
Module
hcn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hcn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hcn_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hcn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HPB14_00960 (ndk)
   00240 Pyrimidine metabolism
    HPB14_00960 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcn04131]
    HPB14_00960 (ndk)
Enzymes [BR:hcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     HPB14_00960 (ndk)
Membrane trafficking [BR:hcn04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    HPB14_00960 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK BTB_2
Motif
Other DBs
NCBI-ProteinID: AFI06907
UniProt: I0EVD8
Structure
PDB: 

Position
194043..194456
Genome map
AA seq 137 aa AA seqDB search
MKQRTLSIIKPDALKKKVVGKIIDRFESNGLEVVAMKRLHLSVKDAENFYAIHRERPFFK
DLIEFMVSGPVVVMVLEGEDAVAKNRDLMGATDPKLAQKGTIRADFAESIDANAVHGSDS
LENAHNEIAFFFAARDL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaaagaacgctgtctattattaaaccggatgcacttaagaaaaaagtggtaggc
aaaatcattgatcgctttgagagtaacggcttggaagtggtggccatgaaacgcttgcat
ttgagcgtgaaagacgctgaaaacttttatgcgatccacagagagagacccttttttaaa
gatttgatagaatttatggtcagtggtccggtggtggttatggttttagagggcgaagat
gccgtggctaaaaacagagatcttatgggagcaactgatcccaaactcgcccaaaaaggc
actatcagagcggattttgctgaaagcattgacgctaatgcggtgcatgggagcgatagc
ttggaaaacgcgcacaatgaaatcgctttcttttttgccgctagagatctttaa

DBGET integrated database retrieval system