KEGG   Helicobacter pylori HUP-B14: HPB14_03240Help
Entry
HPB14_03240       CDS       T02035                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00071  Fatty acid degradation
hcn00072  Synthesis and degradation of ketone bodies
hcn00280  Valine, leucine and isoleucine degradation
hcn00310  Lysine degradation
hcn00362  Benzoate degradation
hcn00380  Tryptophan metabolism
hcn00620  Pyruvate metabolism
hcn00630  Glyoxylate and dicarboxylate metabolism
hcn00640  Propanoate metabolism
hcn00650  Butanoate metabolism
hcn00900  Terpenoid backbone biosynthesis
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
hcn01120  Microbial metabolism in diverse environments
hcn01130  Biosynthesis of antibiotics
hcn01200  Carbon metabolism
hcn01212  Fatty acid metabolism
hcn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPB14_03240
   00630 Glyoxylate and dicarboxylate metabolism
    HPB14_03240
   00640 Propanoate metabolism
    HPB14_03240
   00650 Butanoate metabolism
    HPB14_03240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPB14_03240
   00072 Synthesis and degradation of ketone bodies
    HPB14_03240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPB14_03240
   00310 Lysine degradation
    HPB14_03240
   00380 Tryptophan metabolism
    HPB14_03240
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPB14_03240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPB14_03240
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPB14_03240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcn04147]
    HPB14_03240
Enzymes [BR:hcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPB14_03240
Exosome [BR:hcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPB14_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFI07349
UniProt: I0EWN0
Position
complement(656214..657389)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNNINLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgctttgaatgcg
agctctcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggtgctggt
ttgggtcaaaatatcgccagacagatccaactagacgccggtatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgat
gccatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccctatttgtcgtttgacatgcgagaggggaaaagaatgggaaatgcgaacatgata
gactccatgatccatgatggattgtgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcgagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggtgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgcttttaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggcgcgagcattatcattttatgcagtgct
aaaaaagcgcaaaaattggggttaaaaaccatggcgactatcaaggggtttggtttgggt
ggttgcagtccggatattatgggtatatgccctagtattgcgattaaaaacaatcttaaa
aatgtcaaaatgaatctcaataacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatattagtgacttta
ttgcatgaaatgaaaagaagcgggcatggtgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system