KEGG   Helicobacter pylori HUP-B14: HPB14_04825Help
Entry
HPB14_04825       CDS       T02035                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00450  Selenocompound metabolism
hcn00970  Aminoacyl-tRNA biosynthesis
hcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HPB14_04825
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPB14_04825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hcn01007]
    HPB14_04825
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hcn03016]
    HPB14_04825
Enzymes [BR:hcn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HPB14_04825
Amino acid related enzymes [BR:hcn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HPB14_04825
Transfer RNA biogenesis [BR:hcn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPB14_04825
 Prokaryotic type
   Other AARSs
    HPB14_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e SAC3_GANP CCDC53
Motif
Other DBs
NCBI-ProteinID: AFI07654
UniProt: I0EXI5
Position
complement(1016618..1018570)
Genome map
AA seq 650 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGT
YSGYYCVSCESYCAISKADNTSDKVLCPDCLRETALLEEESYFFRLSAYEKPLLDFYAKN
PEAILPIYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNDLDNKMVHFERARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLNAQKIAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSAKITAYYSKELEKAHQILDNANSFVPKMQLHKALEELFNVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAMKLANAFNTEI
TPNNYERFFKAKKLQDMILQDTEPLFSKMEKIEKAEKAGEASPEKNEKEKKDRKEKAPPK
QENYIGIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGENRLRQIISGIALDYEPESL
VGQMVCVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTREKIAGSLIS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgacatccctcatattggc
catgcttatacgactttgattgcggacactttaaagaagtattacacgctccaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagcgcgagg
ttgaggaatcaaagccccaaagcttacgccgatagcattagcgcgatttttaaaaaccag
tgggattttttcaatttggattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcact
tatagtgggtattattgcgtgagctgtgagagttattgcgcgatctctaaagcggacaac
acgagtgataaagtcttatgccctgattgcttgagggagactgcgcttttagaagaagag
agctattttttcagattgagcgcgtatgaaaagcctttattggatttttacgctaaaaat
cctgaagcgattttgcctatttatcgtaaaaatgaggtaacttcttttattgagcagggt
ttattggatctgtctatcacgcgcacgagctttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggctggacgctttattgaattatgcgagc
gcgttagggtatttgaacgatttagacaataaaatggtgcattttgaacgcgctaggcat
attgtgggtaaggatattttgcgcttccatgccatctattggccagcctttttgatgagt
ttgaatttgcccttattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttaaacgctcaaaaaatcgctatggagtatggg
attgaagaattacgctattttttattgcgtgaagtgccttttgggcaagatggggatttt
tctaaaaaagcgttaatagaaaggatcaacgcgaatttgaataacgatttagggaattta
ttgaatcgtttgttaggcatggctaaaaaatatttcaattattctctaaaaagtgccaaa
atcaccgcttattattctaaagagctagaaaaagcgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttaacgtttatgat
tttttaaacaaactcatcgctaaagaagagccatgggttttgcacaaaaacaacgaatca
gaaaaactagaagccttattgagtttgatcgcaaacgcgctgttgcaatcaagcttctta
ctctatgcgttcatgccaaagagcgctatgaaattagcgaatgctttcaacacagaaatc
acgcccaataattacgaacgcttttttaaagctaaaaaattacaagatatgattttacaa
gacaccgaacctttattttccaaaatggagaaaattgaaaaggctgaaaaagcgggagaa
gcctcaccagaaaaaaacgaaaaagaaaaaaaagatagaaaagaaaaagccccaccaaaa
caagaaaactatatcggcattgaggatttcaaaaaagtagagattaaagtggggcttatc
aaagaagctcaaaggattgaaaagtccaataaattactgcgtttaaaagtggatttaggc
gaaaatcgtttgaggcagattatctcagggatcgctttggattatgagcctgaaagtttg
gtggggcaaatggtgtgcgtggtggctaatttaaaacccgcaaagcttatgggcgaaatg
agtgagggcatgattttagcggtgcgagatagcgataatctggctttaatcagccctacc
agagaaaaaattgcaggaagtttgatcagctaa

DBGET integrated database retrieval system