KEGG   Helicobacter pylori HUP-B14: HPB14_05185Help
Entry
HPB14_05185       CDS       T02035                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00010  Glycolysis / Gluconeogenesis
hcn00020  Citrate cycle (TCA cycle)
hcn00620  Pyruvate metabolism
hcn00640  Propanoate metabolism
hcn00650  Butanoate metabolism
hcn00680  Methane metabolism
hcn01100  Metabolic pathways
hcn01120  Microbial metabolism in diverse environments
hcn01130  Biosynthesis of antibiotics
hcn01200  Carbon metabolism
Module
hcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB14_05185
   00020 Citrate cycle (TCA cycle)
    HPB14_05185
   00620 Pyruvate metabolism
    HPB14_05185
   00640 Propanoate metabolism
    HPB14_05185
   00650 Butanoate metabolism
    HPB14_05185
  Energy metabolism
   00680 Methane metabolism
    HPB14_05185
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPB14_05185
Enzymes [BR:hcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPB14_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFI07721
UniProt: I0EXQ2
Position
1093467..1094027
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIEAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagctggtcaaggcgctatcaccggtgctaaaggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcgttgatgatgagcctattttaaac
catgaacgcttcatgcaaccggattatgtgctggtgattgaccctggtttggttttcatt
gaaaacattttcgctaatgaaaaagaagacacgacctatatcatcactagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccccaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaattgaggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system